Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate WP_011779394.1 MVAN_RS10860 pyruvate carboxylase
Query= SwissProt::I3R7G3 (601 letters) >NCBI__GCF_000015305.1:WP_011779394.1 Length = 1145 Score = 371 bits (953), Expect = e-107 Identities = 206/448 (45%), Positives = 283/448 (63%), Gaps = 12/448 (2%) Query: 3 SKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIG----PARAAD 58 SKVLVANRGEIA+R RA E+G+ TVAVY D++ H ADE+Y IG P RA Sbjct: 6 SKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADESYQIGEIGHPVRA-- 63 Query: 59 SYLDHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTK 118 YL ++ A +A DA++PGYGFL+EN E A D+ T+VGPSA+ +E G K + Sbjct: 64 -YLSVAEIMRVAVEAGCDAVYPGYGFLSENPELAAACADAGITFVGPSANVLELTGNKAR 122 Query: 119 ARSLMQDADVPVVPGTTEPADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVD 178 A + A +PV+ + P+ S +++ A AD +P+ +KA GGGGRG++ V + Sbjct: 123 AIQAARAAGLPVLTSSA-PSASVDELVAAADGMEFPLFVKAVSGGGGRGMRRVTDRAALA 181 Query: 179 GQFETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKV 238 E A RE E+ F + +VY+E+ + PRHIEVQILAD G+V HL ERDCS+QRRHQKV Sbjct: 182 EAVEAASREAESAFGDPNVYLEQAVLNPRHIEVQILADTAGHVMHLFERDCSVQRRHQKV 241 Query: 239 IEEAPSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVED-GEFYFMEVNTRIQVEHT 297 IE AP+P L ++LR++I + A + +Y+ AGTVEFL+++ G F+E N RIQVEHT Sbjct: 242 IELAPAPNLPDELRQKICDDAVAFAKEIDYSCAGTVEFLLDERGHHVFIECNPRIQVEHT 301 Query: 298 VTEEVTGLDVVKWQLRVAAGE---ELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTL 354 VTEE+T +D+V QLR+A+GE +L SQ+ + I G +++ RI E P F P TG + Sbjct: 302 VTEEITDVDLVSSQLRIASGETLADLGLSQETLVIRGAALQCRITTEDPANGFRPDTGRI 361 Query: 355 STYDPPGGIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGL 414 + Y PGG GIR+D G EIG +DSM+ KL G D + RA RAL EF + G+ Sbjct: 362 TAYRSPGGAGIRLDGGAHLGAEIGAHFDSMLVKLTCRGRDFATAVARAHRALAEFRVRGV 421 Query: 415 RTVIPFHRLMLTDEAFREGSHTTKYLDE 442 T IPF + ++ D FR G T ++D+ Sbjct: 422 STNIPFLQAVIDDPDFRAGRVNTSFIDD 449 Score = 55.1 bits (131), Expect = 2e-11 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Query: 509 KPSGPRKRREESD-EGGQQVIEGDGESVAAEMQGTILAVEVDEGDDVEPGDTVCILEAMK 567 +P R R SD ++ + + VAA G ++ V + EGD V+ G T+ +EAMK Sbjct: 1041 RPVVVRDRSVASDIPAAEKADRTNPDHVAAPFAG-VVTVNIAEGDKVDAGQTIATIEAMK 1099 Query: 568 MENDVVAERGGTVSQVLVGEGDSVDMGDVLLVL 600 ME + A + GTV++V V V+ GD+L+V+ Sbjct: 1100 MEAGITAPKSGTVARVAVSATAQVEGGDLLVVI 1132 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1358 Number of extensions: 58 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 601 Length of database: 1145 Length adjustment: 42 Effective length of query: 559 Effective length of database: 1103 Effective search space: 616577 Effective search space used: 616577 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 56 (26.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory