Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011780058.1 MVAN_RS14290 branched-chain amino acid ABC transporter
Query= TCDB::P21628 (417 letters) >NCBI__GCF_000015305.1:WP_011780058.1 Length = 391 Score = 223 bits (569), Expect = 6e-63 Identities = 137/311 (44%), Positives = 182/311 (58%), Gaps = 30/311 (9%) Query: 125 MLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYALLA-------EYAGFGFWTA-------L 170 ++ IGLN+VVG AGLLDLGYVGFYAVGAYT ALL + GF++ + Sbjct: 67 IIAIGLNVVVGQAGLLDLGYVGFYAVGAYTVALLTSPESPWNKLGPTGFFSTPWAWLSCV 126 Query: 171 PIAGMMAALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTEITGGPNGIGSIPKP 230 P+A + AL G +LG P LRLRGDYLAIVTLGFGEIIR+L N+ +IT GP G+ + P Sbjct: 127 PLAMAVTALSGLILGTPTLRLRGDYLAIVTLGFGEIIRLLADNLADITNGPRGLNEVAFP 186 Query: 231 TLFGLTFERRAPEGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVINRLMRMPIGR 290 + PEG+ + G A NY ++ L+L++ L ++ L R +GR Sbjct: 187 HFLE---SDQHPEGVFSVSNSGGDA---NYGTWWFWL-GLILIVGILLLVGNLERSRVGR 239 Query: 291 AWEALREDEVACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTPESFTFIESAM 350 AW A+REDE A +G+N KL AFTIGA+ G +G+ +A + V P +F I S + Sbjct: 240 AWIAVREDEDAAEVMGVNAFKFKLWAFTIGAAIGGLSGALYAGQVQYVAPPTFNIINSML 299 Query: 351 ILAIVVLGGMGSQLGVILAAVVMVLLQEMR--------GFNEYRMLIFGLTMIVMMIWRP 402 L VVLGG G++LGVIL A ++V L + L FGL ++V+MI+RP Sbjct: 300 FLCAVVLGGQGNKLGVILGAFIIVYLPNRLLGVHFLGIDMGNLKYLFFGLALVVLMIFRP 359 Query: 403 QGLLPMQRPHL 413 QGL P R HL Sbjct: 360 QGLFP-ARQHL 369 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 391 Length adjustment: 31 Effective length of query: 386 Effective length of database: 360 Effective search space: 138960 Effective search space used: 138960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory