Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_011780329.1 MVAN_RS15670 DrrA-related ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000015305.1:WP_011780329.1 Length = 334 Score = 115 bits (288), Expect = 1e-30 Identities = 76/222 (34%), Positives = 117/222 (52%), Gaps = 10/222 (4%) Query: 6 VENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEFLGQ 65 V + +G +QA+RDVSFEV GEV+ L+G NGAGKTT + LS L++P SG+ G Sbjct: 10 VAGIKKSFGSVQALRDVSFEVERGEVLGLLGPNGAGKTTTVNILSTLIKPDSGRALIAGH 69 Query: 66 EIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFL----KKNREENQANLKKVFS 121 ++ PA V L + + LT ENL M L KK ++ L + F Sbjct: 70 DVVTDPAG--VRRALMLTGQHAALDDLLTGRENLLMFGRLQGLKKKVAKQRAQELLEQFD 127 Query: 122 RFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQD 181 L + ++ T SGG ++ + + L+ P+++ LDEP+ GL P Q I++++ D Sbjct: 128 ----LVQAADRPVGTYSGGMKRRIDIACGLVVRPEVVFLDEPTTGLDPRSRQAIWELVTD 183 Query: 182 IQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKEL 223 ++ G LL Q +A +SDR V++ G ++ GT EL Sbjct: 184 FKEAGIATLLTTQYLEEADLLSDRIIVIDKGTVIAEGTADEL 225 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 334 Length adjustment: 26 Effective length of query: 210 Effective length of database: 308 Effective search space: 64680 Effective search space used: 64680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory