Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011780329.1 MVAN_RS15670 DrrA-related ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000015305.1:WP_011780329.1 Length = 334 Score = 129 bits (324), Expect = 8e-35 Identities = 90/248 (36%), Positives = 134/248 (54%), Gaps = 23/248 (9%) Query: 1 MTEKSNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYT 60 MT VV VAGI K FG +QAL DV ++RG+V GL+GPNGAGKTT N+++ L Sbjct: 1 MTRSDKAVV--VAGIKKSFGSVQALRDVSFEVERGEVLGLLGPNGAGKTTTVNILSTLIK 58 Query: 61 PDAGTFELAGKPYEPTAVHEVA--KAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLF 118 PD+G +AG H+V AG+ R + L + AL++++ GR +F Sbjct: 59 PDSGRALIAG--------HDVVTDPAGVRRA---LMLTGQHAALDDLLTGRE---NLLMF 104 Query: 119 GAVFRTKGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQL 178 G R +G K + A +RAQELL+ + + AD T S G +RR++IA L P++ Sbjct: 105 G---RLQGLKKKVA--KQRAQELLEQFDLVQAADRPVGTYSGGMKRRIDIACGLVVRPEV 159 Query: 179 IALDEPAAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAE 238 + LDEP G++ + + EL+ + LL ++ L DR+ V+D G IAE Sbjct: 160 VFLDEPTTGLDPRSRQAIWELVTDFKEAGIATLLTTQYLEEADLLSDRIIVIDKGTVIAE 219 Query: 239 GNPAEVQK 246 G E+++ Sbjct: 220 GTADELKE 227 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 334 Length adjustment: 26 Effective length of query: 234 Effective length of database: 308 Effective search space: 72072 Effective search space used: 72072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory