Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_011780353.1 MVAN_RS15790 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000015305.1:WP_011780353.1 Length = 408 Score = 247 bits (631), Expect = 4e-70 Identities = 144/378 (38%), Positives = 219/378 (57%), Gaps = 17/378 (4%) Query: 75 TLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQ--ELLDPLRAMLAKT 132 T+ G+ ++D G G+ NVGH +P VV A+Q Q A+ + + P + L + Sbjct: 40 TVTTADGRSYLDMTSGIGVANVGHCHPRVVEAIQAQAARYAHVNVYGRFVVPEQVELVER 99 Query: 133 LAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRGKFTFIATSGAFHGKSLGALSATA 192 L ++ +SG ES E A+KLA+ + G+ F+A A+HG++LGALS + Sbjct: 100 LTGAAGAGFDMAYLTSSGAESTECAMKLARKHT---GRPKFVAFERAYHGRTLGALSVSW 156 Query: 193 KSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPPPG 252 + +R PF PLL VP+ ++ A A++ D AAVI+EPIQGEGG+ +P Sbjct: 157 REEWRAPFEPLLDEVMFVPYDSLTAAAAAVD------DRTAAVIVEPIQGEGGIRVPSDD 210 Query: 253 YLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGAT 312 +L +R+LCD GAL+I+DEVQ GMGR+G+ FA +H +V+PDI+ +AKA+GGG +P+GA Sbjct: 211 FLPGLRELCDATGALLIVDEVQGGMGRSGRWFAHQHTDVRPDIITMAKAVGGG-LPLGAV 269 Query: 313 IATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQ 372 +A+ E+F+ D P H TT GGNP+ACAA +A +V+ + L + + G+ L G Sbjct: 270 LASAELFATFVDPPLSHLTTMGGNPVACAAGIAAFDVIAD-GLLDRVVEAGEYLRTGLAA 328 Query: 373 LAREYPDLVQEARGKGMLMAIEF-VDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPL 431 L E+ L+ + RG+G+ AIE VD + M + VLV LN + T+RI PPL Sbjct: 329 LCDEFAGLLVDVRGRGLWCAIELSVD---ANPVVARMQQLGVLVGSVLNQSGTVRIMPPL 385 Query: 432 TLTIEQCELVIKAARKAL 449 ++ + + + R L Sbjct: 386 VISDAEIDTFVGVLRTVL 403 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 38 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 408 Length adjustment: 32 Effective length of query: 427 Effective length of database: 376 Effective search space: 160552 Effective search space used: 160552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory