Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_011781166.1 MVAN_RS20085 sugar ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_000015305.1:WP_011781166.1 Length = 274 Score = 235 bits (600), Expect = 6e-67 Identities = 125/252 (49%), Positives = 167/252 (66%), Gaps = 1/252 (0%) Query: 6 PLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDIL 65 PL+ ++ + K +G++ AL + + V GE +LGDNGAGKST IK ++G+H+ T+G +L Sbjct: 19 PLVELKNVGKSYGNITALKDICLRVHAGEVTGILGDNGAGKSTLIKIIAGLHQQTEGQLL 78 Query: 66 FEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYAN 125 +G+P FA P +A+ GIATV+Q+LA++PLM V RNFF+G E +K P L D D Sbjct: 79 VDGEPTKFASPAEALGKGIATVYQNLAVVPLMPVWRNFFLGQELRKKSFPFSL-DADAMR 137 Query: 126 RITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTA 185 T+ E+ KMGI+L D +G+LSGG++Q VAIARAV FGA+VLILDEPT+ALGV+Q+ Sbjct: 138 ATTLTELSKMGIDLPDVDVPIGSLSGGQKQCVAIARAVFFGARVLILDEPTAALGVKQSG 197 Query: 186 NVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEELQDMMA 245 VL I ++ G VVFITHN HA VGD F +LNRG+ DI+ E L MA Sbjct: 198 VVLKYITAAKEAGFGVVFITHNPHHAHLVGDHFVLLNRGRQKLDCTYDDITLEHLTQEMA 257 Query: 246 GGQELATLEGSL 257 GG EL L L Sbjct: 258 GGDELEALTHEL 269 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 274 Length adjustment: 25 Effective length of query: 236 Effective length of database: 249 Effective search space: 58764 Effective search space used: 58764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory