Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_011781340.1 MVAN_RS20985 NAD(P)-dependent oxidoreductase
Query= reanno::Koxy:BWI76_RS22230 (259 letters) >NCBI__GCF_000015305.1:WP_011781340.1 Length = 248 Score = 107 bits (268), Expect = 2e-28 Identities = 84/259 (32%), Positives = 125/259 (48%), Gaps = 13/259 (5%) Query: 1 MNQVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSDKATRVAQSINAEYGEGT-AWGFG 59 M +VAVV GG +GE C L G +VAV+D+ A RVA+ + G+G A G Sbjct: 1 MTRVAVVTGGASGMGEATCHELGRRGCKVAVLDLDGQAAQRVAEELR---GDGVPALGVA 57 Query: 60 ADATSEASVVALARGVDDIFSRVDLLVYSAGIAKAAFISDFALGDFDRSLQVNLVGYFLC 119 AD T A+V V V +LV SAG+ A + + + R ++VNL G F C Sbjct: 58 ADVTDRAAVEDAFAKVRTELGPVHILVTSAGLVDFAPFLEISPDRWQRLIEVNLNGTFHC 117 Query: 120 AREFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITV 179 A+ M+ G GRI+ I+S S + GS + Y+A+K + T+SLA + GITV Sbjct: 118 AQVAIPDMLAAG-WGRIVMISSSSAQRGSPGMAHYAASKGALISFTRSLAREYGPAGITV 176 Query: 180 HSLMLGNLLKSPMFQSLLPQYATKLGIPEEQVEQYYIDKVPLKRGCDYQDVLNVLMFYAS 239 +++ + QS + P EQ+ +P+ D+ + F S Sbjct: 177 NNVPPSGIETPMQHQSQAAGFLP----PNEQMAA----SIPVGHLGTGDDIAAAVGFLCS 228 Query: 240 PQASYCTGQSINVTGGQVM 258 +A + TGQ++ V GG VM Sbjct: 229 EEAGFITGQTLGVNGGSVM 247 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 248 Length adjustment: 24 Effective length of query: 235 Effective length of database: 224 Effective search space: 52640 Effective search space used: 52640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory