Align D-lactate dehydrogenase (acceptor) (EC 1.1.99.6) (characterized)
to candidate WP_011781617.1 MVAN_RS22430 FAD-binding oxidoreductase
Query= BRENDA::O29853 (443 letters) >NCBI__GCF_000015305.1:WP_011781617.1 Length = 453 Score = 246 bits (627), Expect = 1e-69 Identities = 155/425 (36%), Positives = 226/425 (53%), Gaps = 20/425 (4%) Query: 31 PRAAENFVVVKPSNSEEVSAILKFANEKSIPVFMRGGGTGLSGGAVPTEEGIVLSTEKMT 90 P A VV+P +EEV A L++A I V RG GTGLSGGA + GIVLSTEKM Sbjct: 34 PSAGTPIAVVRPRRTEEVQATLRWATAHRIAVVPRGMGTGLSGGATALDGGIVLSTEKMR 93 Query: 91 ELEVDADNRVAICGAGVTLKQLDDAAFRHGLSFPPHPGA-ETATVGGMIATNAGGVRALK 149 ++ VD R A+ G+ ++ A +GL +PP P + E ++GG IATNAGG+ +K Sbjct: 94 DITVDPVTRTAVAQPGLLNAEVKKAVAEYGLWYPPDPSSFEICSIGGNIATNAGGLCCVK 153 Query: 150 YGTMRNYVLSLEAVLADGRIINVGGKTIKNSSGYSLLHLLVGSEGTLAVITKATIRLFPQ 209 YG +YVL L+ VLADG + +GG +K+ +G SL L VGSEGTL V+T+ T++L P Sbjct: 154 YGVTTDYVLGLQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGSEGTLGVVTEVTLKLLPA 213 Query: 210 MRDMTVLAIPFPTMEDAMNCVVEVARKMLPMALEFMEKRAVEIGEKVSGERWVSREGEAH 269 + F ++EDA N VV + K+ P LEFM+ A+ V + + + A Sbjct: 214 QSGACTVVATFDSVEDAANAVVTITGKIRPSMLEFMDSAAI---NAVEDKLKMGLDRSAA 270 Query: 270 LLMVFESFDEAEEAAKIAQSL-------GAIDVYAATTKKDQDRLLKVRGMIYEGLR-KE 321 +MV S D A+ A+ + GA +V++ + + + + R + + Sbjct: 271 AMMVAASDDRGPSGAQDAEFMAGVFTEHGAREVFSTSDPDEGEAFVAARRFAIPAVEARG 330 Query: 322 VIEVLDACVPPAKIAEYWRRSNELAEEYGIELITYGHAGDGNVHQHPLVYEGWEKSYFEF 381 + + D VP +AE ++A + + + HAGDGN HPL+ + E Sbjct: 331 ALLLEDVGVPLPALAELVGGVEKIAGHHELMISVIAHAGDGNT--HPLIVFDPDDPDMER 388 Query: 382 RK-----SLLSLAVSLGGVISGEHGIGAVKLSELE-ELFPEQFELMRQIKLLFDPKNILN 435 R ++ LA+ LGG I+GEHG+G +K L +L PE EL R+IK DP ILN Sbjct: 389 RAQQAFGEIMDLAIGLGGTITGEHGVGRLKRPWLAGQLGPEAMELNRRIKQALDPDGILN 448 Query: 436 PGKVV 440 PG + Sbjct: 449 PGAAI 453 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 453 Length adjustment: 33 Effective length of query: 410 Effective length of database: 420 Effective search space: 172200 Effective search space used: 172200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory