Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate WP_011781969.1 MVAN_RS24230 NAD(P)-dependent oxidoreductase
Query= SwissProt::P28811 (298 letters) >NCBI__GCF_000015305.1:WP_011781969.1 Length = 294 Score = 170 bits (430), Expect = 4e-47 Identities = 111/292 (38%), Positives = 157/292 (53%), Gaps = 14/292 (4%) Query: 2 TDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVV 61 T++ F+GLGNMG P+ L++AGHRV VFD + V V GA+ SA + AE V Sbjct: 3 TELGFVGLGNMGFPIMTRLVEAGHRVLVFDTRADVVAQAVRAGAEARTSARDVADRAETV 62 Query: 62 ISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPV 121 ++ LP Q S+ +A + +D ST+ + A++ E +A+G+ LD+PV Sbjct: 63 LASLPTPQVSNSVA----SEVAEGSRVRRFVDLSTVGQQAAQRNREVLSARGIAALDSPV 118 Query: 122 SGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGIL 181 SGGV GARAGTL+ +V GP F V +GR IF + GA Q K+ NN++ Sbjct: 119 SGGVHGARAGTLAVMVSGPRPEFEALASVFAVLGRAIFVSEQPGAAQTMKLINNLMAATA 178 Query: 182 MAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQV 241 +A TAE + +GVK GLDP V+ +V+ SGG A P+A + GF Sbjct: 179 LAATAEVMVMGVKAGLDPQVVIDVLNAGSGGTHASR------DKFPRAVLPRTFDYGFAT 232 Query: 242 RLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQA-DAEHEGLDFSSIQK 292 LM KD+ L L A+A+ TP+ ALA ++ L Q D E DF+S+ K Sbjct: 233 GLMTKDVLLYLDEARAL--GTPV-ALAESVMRLWEQTQDEEGPSSDFTSVVK 281 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 294 Length adjustment: 26 Effective length of query: 272 Effective length of database: 268 Effective search space: 72896 Effective search space used: 72896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory