Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_011782230.1 MVAN_RS25590 phosphate ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000015305.1:WP_011782230.1 Length = 256 Score = 107 bits (266), Expect = 3e-28 Identities = 75/250 (30%), Positives = 128/250 (51%), Gaps = 19/250 (7%) Query: 2 LQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGS----PQAH-SG 56 L ++++ +YG A+ V + V + IG +G GKST+L TL P A G Sbjct: 5 LDLKDLNIYYGSFHAVADVGLSVMPRSVTAFIGPSGCGKSTVLRTLNRMHEVLPGARVEG 64 Query: 57 SIRYMGEELVGQDSSHI-MRKSIAVVPEGRRVFARLTVEENLAMG----GFFTDKGDYQE 111 S+ GE++ + +RK+I +V + F +++ +N+ G G + D E Sbjct: 65 SVLLDGEDIYASGVDPVSVRKTIGMVFQRPNPFPTMSIRDNVVAGLKLQGVRRNLDDIAE 124 Query: 112 QMDKVLHLFPRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQ 171 + K +L+ +K+R + GG +SGG+QQ L I RA+ +P +LL+DEP L PI Sbjct: 125 KSLKGANLWNEVKDRLDKPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLA 184 Query: 172 IFDIIEQLRKDGVTVFLVEQNANQALKIADRAYVL------ENGRVVMQGTGEALLTDP- 224 I D+I +L++D T+ +V N QA +++D+ + GR++ E + ++P Sbjct: 185 IEDLISELKQD-YTIVIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEVDDTEKIFSNPS 243 Query: 225 -KVREAYLGG 233 K E Y+ G Sbjct: 244 QKATEDYISG 253 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 256 Length adjustment: 24 Effective length of query: 209 Effective length of database: 232 Effective search space: 48488 Effective search space used: 48488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory