Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_011782423.1 MVAN_RS26560 acetyl-CoA C-acyltransferase
Query= BRENDA::Q0K368 (391 letters) >NCBI__GCF_000015305.1:WP_011782423.1 Length = 382 Score = 380 bits (975), Expect = e-110 Identities = 202/393 (51%), Positives = 268/393 (68%), Gaps = 13/393 (3%) Query: 1 MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALVEDVIMGCVSQVG 60 MAEAY++ AVRTA G++ G L+G HP DL A L R DP V+DVI GCV +G Sbjct: 1 MAEAYVIDAVRTAIGKRNGSLAGMHPVDLGAAGWRGLFARNDVDPGAVDDVIAGCVDAIG 60 Query: 61 EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120 QAGN+AR + LA+ PE VPG +VDRQCGSSQQA+ F AQA++SG D+++A G+++M+ Sbjct: 61 PQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGAQAILSGTADLIVAGGMQNMS 120 Query: 121 RVPMGLSSQLPAKNGFGVP--KSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYAL 178 ++P+ + + + GF P +S RY + SQF GAEMIA K+D+SRE ++ +AL Sbjct: 121 QIPISSAMIVGEQFGFTSPTNESKSWLHRYGDQEISQFRGAEMIAEKWDISREDMEQFAL 180 Query: 179 QSHQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVKLIAEGG 238 S+QRA AA ++G F EI+ V DG DE R + TLE + +K + +GG Sbjct: 181 TSNQRAQAAIRAGHFENEIIDV-----DGFR-----VDECPR-ETTLEKMAGLKTLVDGG 229 Query: 239 RVTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVA 298 R+TAA ASQI DGA+ +++ +E +K +KP AR+H ++ G DPV ML P+PAT+ A Sbjct: 230 RLTAAMASQISDGASAVLLASENAVKVHNLKPRARIHHISARGADPVFMLTGPIPATQYA 289 Query: 299 LKKAGLRIGDIDLFEVNEAFAPVPLAWLKATGADPARLNVHGGAIALGHPLGGSGAKLMT 358 L +AGL I DID E+NEAFAPV AWLK T ADP ++N +GGAIALGHPLG +GAKL Sbjct: 290 LDRAGLTIEDIDTVEINEAFAPVVQAWLKETKADPEKVNPNGGAIALGHPLGATGAKLFA 349 Query: 359 TLVHALHTHGKRYGLQTMCEGGGLANVTIVERL 391 T+++ L G RYGLQTMCEGGG ANVTI+ERL Sbjct: 350 TMLNTLERTGGRYGLQTMCEGGGTANVTIIERL 382 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 382 Length adjustment: 30 Effective length of query: 361 Effective length of database: 352 Effective search space: 127072 Effective search space used: 127072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory