Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011782856.1 MVAN_RS28880 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000015305.1:WP_011782856.1 Length = 348 Score = 113 bits (283), Expect = 4e-30 Identities = 72/230 (31%), Positives = 122/230 (53%), Gaps = 14/230 (6%) Query: 12 LQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVFE 71 +Q++ + YG RAL G +H+ GE+V+L+G +G GK+T + + G +A +G+V Sbjct: 10 VQLDELTRVYGTTRALDGFTLHIEPGELVALLGPSGCGKTTALRILAGLDEATSGTVAVG 69 Query: 72 GRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMG------AGLDNLKHFAEDVEK 125 G D++++P ++ + Q+ +FP +TVL+N+ G A D L A+ +E Sbjct: 70 GVDVSKVPANKRDMGMVFQAYS---LFPHLTVLDNVAFGLKMRGKAKRDRLSRAADMLEL 126 Query: 126 IFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEA 185 + L E + LSGG+QQ +++ RAL RP++LLLDEP L + + + Sbjct: 127 V-----GLGELGGRYAKELSGGQQQRVALARALAIRPRVLLLDEPLSALDAKVRTQLRDE 181 Query: 186 IRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANP 235 IR++ G T V + AL ++ R VM G++ + +L ANP Sbjct: 182 IRRVQLEVGTTTLFVTHDQEEALAVADRVGVMNEGRLEQLAAPADLYANP 231 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 348 Length adjustment: 26 Effective length of query: 221 Effective length of database: 322 Effective search space: 71162 Effective search space used: 71162 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory