Align gluconokinase (EC 2.7.1.12) (characterized)
to candidate WP_011783026.1 MVAN_RS29740 gluconate kinase
Query= BRENDA::Q8NMT0 (167 letters) >NCBI__GCF_000015305.1:WP_011783026.1 Length = 169 Score = 155 bits (393), Expect = 2e-43 Identities = 79/146 (54%), Positives = 97/146 (66%), Gaps = 1/146 (0%) Query: 9 IVVMGVSGCGKSSVGKALAAELGIEYKDGDELHPQENIDKMASGQALDDDDRAWWLVQVG 68 IVVMGVSG GKS+VG ALA L + + D D+ HP NI KM++G LDD+DR WL +G Sbjct: 5 IVVMGVSGSGKSTVGAALAQRLRVPFADADDFHPPANIAKMSAGHPLDDEDRYPWLESIG 64 Query: 69 KWLRDRPSG-VIACSALKRSYRDLLRTKCPGTVFVHLHGDYDLLLSRMKAREDHFMPSTL 127 +WL P G V++CSALKRSYRD LR CP F+HL G + + R +R HFMP+ L Sbjct: 65 EWLARHPQGGVMSCSALKRSYRDQLRRHCPDIEFLHLEGSVETIGRRQASRPGHFMPAAL 124 Query: 128 LDSQFATLEPLEDDEDGKVFDVAHTI 153 L+SQF TLEPLE E G DV +I Sbjct: 125 LESQFETLEPLEPGERGVTVDVDQSI 150 Lambda K H 0.318 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 95 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 167 Length of database: 169 Length adjustment: 18 Effective length of query: 149 Effective length of database: 151 Effective search space: 22499 Effective search space used: 22499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory