Align phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate WP_011800527.1 PNAP_RS05595 phenylalanine 4-monooxygenase
Query= BRENDA::P30967 (297 letters) >NCBI__GCF_000015505.1:WP_011800527.1 Length = 299 Score = 332 bits (851), Expect = 6e-96 Identities = 153/261 (58%), Positives = 198/261 (75%) Query: 26 DFTLPQPLDRYSAEDHATWATLYQRQCKLLPGRACDEFMEGLERLEVDADRVPDFNKLNQ 85 D+T+ Q DRY+A++HATW TL++RQ +LL GRACDEF+ G+ L + AD++PDF +L+ Sbjct: 25 DWTIEQGWDRYTAQEHATWKTLFERQSRLLLGRACDEFVSGMADLPIGADQIPDFRRLSD 84 Query: 86 KLMAATGWKIVAVPGLIPDDVFFEHLANRRFPVTWWLREPHQLDYLQEPDVFHDLFGHVP 145 LM TGW++VAVPGL+PD+VFFEHLANRRFP ++R+P QLDYL+EPDVFHD+FGHVP Sbjct: 85 ILMQRTGWQVVAVPGLVPDEVFFEHLANRRFPAGQFIRKPDQLDYLEEPDVFHDVFGHVP 144 Query: 146 LLINPVFADYLEAYGKGGVKAKALGALPMLARLYWYTVEFGLINTPAGMRIYGAGILSSK 205 +L+NP ADY++AYG GG++A+ LG L LAR+YWYTVEFGL+ G+RIYGAGI SS Sbjct: 145 MLMNPAIADYIQAYGAGGLRAQQLGVLDKLARVYWYTVEFGLVKQKDGLRIYGAGIASSA 204 Query: 206 SESIYCLDSASPNRVGFDLMRIMNTRYRIDTFQKTYFVIDSFKQLFDATAPDFAPLYLQL 265 SES++ LD ASPNR+ FDL R+M T YRID FQ+TYFVID+ +L DFAPLY ++ Sbjct: 205 SESVFALDDASPNRIRFDLERVMRTNYRIDDFQETYFVIDNLDELLALARIDFAPLYERV 264 Query: 266 ADAQPWGAGDVAPDDLVLNAG 286 + G V D V+ G Sbjct: 265 QGQPDYEPGSVLACDQVITQG 285 Lambda K H 0.323 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 297 Length of database: 299 Length adjustment: 27 Effective length of query: 270 Effective length of database: 272 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_011800527.1 PNAP_RS05595 (phenylalanine 4-monooxygenase)
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.6457.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-107 344.7 0.1 1.4e-107 344.5 0.1 1.0 1 lcl|NCBI__GCF_000015505.1:WP_011800527.1 PNAP_RS05595 phenylalanine 4-mon Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015505.1:WP_011800527.1 PNAP_RS05595 phenylalanine 4-monooxygenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.5 0.1 1.4e-107 1.4e-107 1 245 [. 25 270 .. 25 273 .. 0.98 Alignments for each domain: == domain 1 score: 344.5 bits; conditional E-value: 1.4e-107 TIGR01267 1 dftvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwk 69 d+t++q++dry+++eha+w+tl++rq +ll gracde++ G+ l + ad+ipd+ +++ l++ tGw+ lcl|NCBI__GCF_000015505.1:WP_011800527.1 25 DWTIEQGWDRYTAQEHATWKTLFERQSRLLLGRACDEFVSGMADLPIGADQIPDFRRLSDILMQRTGWQ 93 6799***************************************************************** PP TIGR01267 70 ivavpglipadvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayGkkg 138 +vavpgl+p++vffehlanrrfp +f+r+p++ldyl epdvfhd+fGhvp+l+np ad+++ayG +g lcl|NCBI__GCF_000015505.1:WP_011800527.1 94 VVAVPGLVPDEVFFEHLANRRFPAGQFIRKPDQLDYLEEPDVFHDVFGHVPMLMNPAIADYIQAYGAGG 162 ********************************************************************* PP TIGR01267 139 vkakalgaa.llarlywytvefGlvetaaglriyGaGilsskkelvyaleskeplrvafdllevmrtry 206 ++a++lg lar+ywytvefGlv++++glriyGaGi ss +e+v+al+ ++p+r+ fdl++vmrt+y lcl|NCBI__GCF_000015505.1:WP_011800527.1 163 LRAQQLGVLdKLARVYWYTVEFGLVKQKDGLRIYGAGIASSASESVFALDDASPNRIRFDLERVMRTNY 231 *******9769********************************************************** PP TIGR01267 207 ridklqkayfvlpslkrlfdaaqedfealvaeakdlkal 245 rid +q++yfv+++l++l +a+ df++l+ + + + + lcl|NCBI__GCF_000015505.1:WP_011800527.1 232 RIDDFQETYFVIDNLDELLALARIDFAPLYERVQGQPDY 270 ******************************998877655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (299 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.84 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory