Align GDP-6-deoxy-D-talose 4-dehydrogenase (EC 1.1.1.135); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC 1.1.1.178) (characterized)
to candidate WP_011802091.1 PNAP_RS13545 3-oxoacyl-ACP reductase
Query= BRENDA::Q99714 (261 letters) >NCBI__GCF_000015505.1:WP_011802091.1 Length = 286 Score = 145 bits (365), Expect = 1e-39 Identities = 96/251 (38%), Positives = 138/251 (54%), Gaps = 15/251 (5%) Query: 12 VAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDV 71 VA++TG A G+G ATA+RL G LLDL +A+A +LG+ + DVTSE+ V Sbjct: 21 VAIVTGAADGIGWATAQRLAADGLRVALLDLRADAAQARAAELGSIHLGLGCDVTSEESV 80 Query: 72 QTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQT--HTLEDFQRVLDVNLMGTFNVI 129 + A+A +FGR+D VN AGI + G T +++ F RVL V+L GTF + Sbjct: 81 EAAVAAVLERFGRIDALVNNAGIGDQT-------GPTTEQSVQAFDRVLAVHLRGTFLMS 133 Query: 130 RLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPI 189 R VA M Q P G RG I+N S+A+ G + AYSA K G++GMT +A + A Sbjct: 134 RAVARHMLQAAPVPGRGRGAIVNLGSIASSTGLPARNAYSAGKAGVLGMTRAMASEWARA 193 Query: 190 GIRVMTIAPGLFGTPLLTSLPEKVCNFLAS---QVPFPSRLGDPAEYAHLVQAIIEN--P 244 GIRV +APG T L+ L K A+ + P R+ +PAE A ++ + + Sbjct: 194 GIRVNAVAPGYVRTALVAELERKGAIDAAAIRRRTPL-GRMAEPAEIAEVIAFLASDRAS 252 Query: 245 FLNGEVIRLDG 255 ++ G +I +DG Sbjct: 253 YVTGALIPVDG 263 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 286 Length adjustment: 25 Effective length of query: 236 Effective length of database: 261 Effective search space: 61596 Effective search space used: 61596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory