Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_011802842.1 PNAP_RS17350 acetyl-CoA C-acyltransferase
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_000015505.1:WP_011802842.1 Length = 399 Score = 346 bits (887), Expect = e-100 Identities = 195/395 (49%), Positives = 252/395 (63%), Gaps = 8/395 (2%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGN-IDDLIIGCATP 59 ++EA IV+ RTP+G++ +G RPDDL +K L + + I+D+I GCA P Sbjct: 5 VQEAYIVAATRTPIGRSHRGFFRNTRPDDLLVSVLKAALAQVPTLDPKAIEDIICGCAIP 64 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 E QGLN+AR LAGLP +V ITVNR+C+SGL +I AA++I +G D A G ES Sbjct: 65 EGPQGLNIARIGAVLAGLPTSVGGITVNRFCASGLSAIQMAADRIRVGEADVMFAAGTES 124 Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMS----MGHTAEQVAKKYGVSREDQDAFAVRSHQN 175 MS VPM G+ P+L+ A A + + MG TAE+VA+++ VSR QD FA SH Sbjct: 125 MSMVPMSGN--SPSLSPAMFANDENVGIAYGMGLTAEKVAQQWKVSRAAQDQFAYESHMK 182 Query: 176 AAKALAEGKFKDEIVPVEVTVTEIG-EDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAF 234 A KA G+F EI PVEVT E + + S DEG RP TT + L+ L+ F Sbjct: 183 ALKAQQAGEFSAEITPVEVTDRTANLETGEVIATTRTVSLDEGARPDTTLEGLAKLKTPF 242 Query: 235 SVDGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEA 294 + G+VTAGNSSQTSDGA A++L + GL PL +F S+A GVPPE+MGIGP+EA Sbjct: 243 AARGSVTAGNSSQTSDGAGALILASEKAVKEFGLKPLARFVSYAAKGVPPEIMGIGPIEA 302 Query: 295 IPRALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGT 354 IP AL+ AGL DI FELNEAFA+Q++ VI LG+D KVN GGAIALGHPLG TG Sbjct: 303 IPAALRYAGLTQNDIDWFELNEAFAAQSLAVINTLGLDPAKVNPMGGAIALGHPLGATGA 362 Query: 355 KLTLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 ++IH + R ++G+VTMC+G G GAAG+FE Sbjct: 363 IRAATVIHALHRHQLKYGMVTMCVGMGQGAAGIFE 397 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 399 Length adjustment: 31 Effective length of query: 360 Effective length of database: 368 Effective search space: 132480 Effective search space used: 132480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011802842.1 PNAP_RS17350 (acetyl-CoA C-acyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.937886.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-143 464.8 4.0 1.2e-143 464.6 4.0 1.0 1 NCBI__GCF_000015505.1:WP_011802842.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000015505.1:WP_011802842.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 464.6 4.0 1.2e-143 1.2e-143 1 385 [] 10 397 .. 10 397 .. 0.97 Alignments for each domain: == domain 1 score: 464.6 bits; conditional E-value: 1.2e-143 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaalaagl 70 iv+a+Rtpig + +g +++++++dLl+ v+k++l+++ ldp++i+++i+G+++++g q niaR a+ agl NCBI__GCF_000015505.1:WP_011802842.1 10 IVAATRTPIGrSHRGFFRNTRPDDLLVSVLKAALAQVpTLDPKAIEDIICGCAIPEGPQgLNIARIGAVLAGL 82 8**********89************************************************************ PP TIGR01930 71 pesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkd 143 p+sv ++tvnr+CaSgl A+++aa++i++Geadv+ a+G EsmS vp++ ++ sl++ + +++ NCBI__GCF_000015505.1:WP_011802842.1 83 PTSVGGITVNRFCASGLSAIQMAADRIRVGEADVMFAAGTESMSMVPMSGNSP----SLSPAMFANDE----- 146 ***********************************************988875....77776666666..... PP TIGR01930 144 lvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk............kkv 204 v ++ mg tAe++a+++++sR qD++a++Sh+ka kA+++g+f++ei+pvev ++ +++ NCBI__GCF_000015505.1:WP_011802842.1 147 NVGIAYGMGLTAEKVAQQWKVSRAAQDQFAYESHMKALKAQQAGEFSAEITPVEVTDRtanletgeviatTRT 219 45678***************************************************99***********999* PP TIGR01930 205 vskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagv 277 vs Deg rp+ttle LakLk+ f+ gs vtAgNssq++DGA+al+l+se+++ke+gl+plar+vs+a gv NCBI__GCF_000015505.1:WP_011802842.1 220 VSLDEGARPDTTLEGLAKLKTPFAA-RGS-VTAGNSSQTSDGAGALILASEKAVKEFGLKPLARFVSYAAKGV 290 ***********************96.8*7.******************************************* PP TIGR01930 278 dpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGa 350 +pe+mg+gp++Ai++aL+ agl+ +did++E+nEAFAaq lav++ lg ld++kvN GGAiAlGHPlGa+Ga NCBI__GCF_000015505.1:WP_011802842.1 291 PPEIMGIGPIEAIPAALRYAGLTQNDIDWFELNEAFAAQSLAVINTLG-LDPAKVNPMGGAIALGHPLGATGA 362 ************************************************.99********************** PP TIGR01930 351 rivltllkeLkergkkyGlatlCvggGqGaAvile 385 + +t++++L++++ kyG++t+Cvg+GqGaA i+e NCBI__GCF_000015505.1:WP_011802842.1 363 IRAATVIHALHRHQLKYGMVTMCVGMGQGAAGIFE 397 ********************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 13.73 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory