Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate WP_011803053.1 PNAP_RS18450 sugar ABC transporter permease
Query= uniprot:A8LLL5 (334 letters) >NCBI__GCF_000015505.1:WP_011803053.1 Length = 293 Score = 104 bits (259), Expect = 3e-27 Identities = 74/244 (30%), Positives = 127/244 (52%), Gaps = 12/244 (4%) Query: 90 QWVGLDNYAQMASEPKFWEAMRNNMFWLIVVPALSTAFGLLAAQLTDRIKWGNVAKSIIF 149 ++VGL Y ++ ++W A++N + ++ S G++ A D+ G A II+ Sbjct: 48 EFVGLAQYERLFEMDRWWVALKNLGIFSLLYVGGSMLIGMVLAIFLDQKVRGEGALRIIY 107 Query: 150 M-PMAISFVGASVIWKLVYDGRPIEQEQIGILNAIIVGLGGDPVTF--LTIPFWNNFFLM 206 + PMA+SF+ WK + + +G L ++ LG F L + + ++ Sbjct: 108 LYPMALSFIVTGTAWKWILN------PSLG-LEKLMHDLGWASFHFDWLVQSDFAIYCVV 160 Query: 207 IVLVWVQTGFAMVILSAALRGIPEETIEAAIIDGASPLQIFFKIKVPQIMPTVVVVWTTI 266 I +W GFAM + A LRGI + I+AA IDGAS +I+++I +P + P V + Sbjct: 161 IAGIWQSAGFAMALFLAGLRGIDDSIIKAAQIDGASLPRIYWRILLPILRPVVFSTILVL 220 Query: 267 TLVVLKVFDIVFAMTNG--QWETQVLANYMFDKLFRANDWGVGSASAMVIMLLVTPILIW 324 + +K FD+V A+TNG + T V A +MF F G+G+ASA +++ V I++ Sbjct: 221 AHLSIKSFDLVMALTNGGPGYATDVPATFMFVMSFTRGQIGLGAASATMMLATVAAIVVP 280 Query: 325 NIHS 328 ++S Sbjct: 281 YLYS 284 Lambda K H 0.329 0.143 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 293 Length adjustment: 27 Effective length of query: 307 Effective length of database: 266 Effective search space: 81662 Effective search space used: 81662 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory