Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_011813570.1 HHAL_RS03940 UDP-glucose 4-epimerase GalE
Query= curated2:Q9KDV3 (334 letters) >NCBI__GCF_000015585.1:WP_011813570.1 Length = 329 Score = 347 bits (891), Expect = e-100 Identities = 168/318 (52%), Positives = 214/318 (67%) Query: 1 MAILVTGGAGYIGSHTVLFLLEQGEQVIVLDNLQKGHAGALSDVTFYHGDIRDDQLLDTI 60 M ILVTGGAGYIGSH V LL G +V+ LDNL GH A+ + GD++D L T+ Sbjct: 1 MTILVTGGAGYIGSHMVRRLLADGYEVVALDNLSTGHRWAVPEECLEVGDLQDRDALSTL 60 Query: 61 FTTHSIDTVIHFAANSLVGESVKQPIEYYENNVIGTHTLLKKMLEHDVKKIVFSSTAATY 120 F + V+HFAA+SLVGES ++P+EY+ENNV GT LL+ LE +++FSS+AA Y Sbjct: 61 FQRYRFSAVVHFAASSLVGESEERPLEYHENNVGGTLNLLRACLELGTTRLIFSSSAAVY 120 Query: 121 GEPVQIPIQESDPTIPTNPYGETKLAIEKMFHWCQEAYGLQYVCLRYFNAAGADPNGRIG 180 G P + PI ES P NPYG +K+ E+M L++V LRYFNAAGADP GR+G Sbjct: 121 GAPSESPIPESVAPAPINPYGVSKMVCERMLADVSVGTSLRFVSLRYFNAAGADPKGRLG 180 Query: 181 EDHSPESHLIPIVLQVALGQRERVAIFGDDYQTEDGSCIRDYIHVMDLANAHYLACEHLR 240 E H PE+HLIP +LQV G+ ++GDDY T DG+CIRDYIHV DL AH +A HL Sbjct: 181 ECHEPETHLIPRLLQVVSGRSAGFTLYGDDYPTPDGTCIRDYIHVEDLVEAHVIALAHLE 240 Query: 241 KDGQSGSFNLGNGKGFSVKEVIEVCRQVTGHPIPAEIAPRRSGDPASLIASSEKAQTILG 300 G+S +FN G G+G+SV+EVIEV R VTGHP+P ++ PRR GDP+ L+A + LG Sbjct: 241 AGGESRTFNCGYGRGYSVREVIEVARAVTGHPLPVDVGPRRPGDPSQLVADGSALRETLG 300 Query: 301 WEPKYPSLETMVEHAWNW 318 W P+Y SLET+V AW W Sbjct: 301 WRPRYESLETIVRDAWRW 318 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 329 Length adjustment: 28 Effective length of query: 306 Effective length of database: 301 Effective search space: 92106 Effective search space used: 92106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011813570.1 HHAL_RS03940 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.20417.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-133 430.4 0.0 2.1e-133 430.2 0.0 1.0 1 lcl|NCBI__GCF_000015585.1:WP_011813570.1 HHAL_RS03940 UDP-glucose 4-epime Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000015585.1:WP_011813570.1 HHAL_RS03940 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 430.2 0.0 2.1e-133 2.1e-133 2 329 .. 3 323 .. 2 326 .. 0.99 Alignments for each domain: == domain 1 score: 430.2 bits; conditional E-value: 2.1e-133 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeek 70 iLvtGgaGyiGsh+vr ll+ g+evv lDnls+g+++a++++ l gdl+d+ +l++++++ + lcl|NCBI__GCF_000015585.1:WP_011813570.1 3 ILVTGGAGYIGSHMVRRLLADGYEVVALDNLSTGHRWAVPEEC------LEVGDLQDRDALSTLFQRYR 65 9***************************************988......999***************** PP TIGR01179 71 idaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEespl 139 + av+Hfaa+ vgEs ++Pl+Y ennv +tl+Ll+a+ + g ++liFsssaavYg ++++pi E+ + lcl|NCBI__GCF_000015585.1:WP_011813570.1 66 FSAVVHFAASSLVGESEERPLEYHENNVGGTLNLLRACLELGTTRLIFSSSAAVYGAPSESPIPESVAP 134 ********************************************************************* PP TIGR01179 140 npinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkre 208 +pinpYG sk++ Er+l d++ ++l++v+LRYFn+aGAd++g++Ge ++++thli+++++v++g+ lcl|NCBI__GCF_000015585.1:WP_011813570.1 135 APINPYGVSKMVCERMLADVSVG-TSLRFVSLRYFNAAGADPKGRLGECHEPETHLIPRLLQVVSGRSA 202 ********************777.********************************************* PP TIGR01179 209 kleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgk 277 ++++G+dypt+DGtc+RDyiHveDl eaH+ al le+gges+++n+G+g+g+sv+evie +++v+g+ lcl|NCBI__GCF_000015585.1:WP_011813570.1 203 GFTLYGDDYPTPDGTCIRDYIHVEDLVEAHVIALAHLEAGGESRTFNCGYGRGYSVREVIEVARAVTGH 271 ********************************************************************* PP TIGR01179 278 dikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklk 329 +++v + +rR+GDp++lvad s +++lgw+p+y+ Le+i+++aw+We++l+ lcl|NCBI__GCF_000015585.1:WP_011813570.1 272 PLPVDVGPRRPGDPSQLVADGSALRETLGWRPRYESLETIVRDAWRWESRLQ 323 ************************************************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.80 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory