Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_011840164.1 RSPH17029_RS00495 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_000015985.1:WP_011840164.1 Length = 367 Score = 322 bits (825), Expect = 1e-92 Identities = 184/363 (50%), Positives = 243/363 (66%), Gaps = 12/363 (3%) Query: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 MA L++ + K++ VL +I+L I++GE +VFVGPSGCGKSTLLRMI GLE T GT+ Sbjct: 1 MAFLEIRSLCKSFESYPVLKDIDLSIEKGEFVVFVGPSGCGKSTLLRMITGLETPTSGTI 60 Query: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 I+ V+NDV PA+RG AMVFQSYALYPHMTV +N+SF L++++K +A I VE AA Sbjct: 61 AIEDEVINDVDPARRGTAMVFQSYALYPHMTVFQNISFGLRMSRKPKALIRERVEKAAAI 120 Query: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 L+L + LDR P LSGGQ+QRVAIGR+IVR+P+V+LFDEPLSNLDA LRV R E+ +L Sbjct: 121 LRLDKLLDRKPAQLSGGQKQRVAIGRAIVREPRVFLFDEPLSNLDAELRVQMRAELLELH 180 Query: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 E + +TM+YVTHDQVEAMTLA ++VV++GG I Q G PL+LY+ P+N FVA F+GSPKM Sbjct: 181 ERL-GTTMIYVTHDQVEAMTLADKMVVMSGGRIQQYGRPLDLYDDPDNRFVAGFVGSPKM 239 Query: 241 NLLPGKIIGTGAQ-TTVEMTDGGRAVSDYPSDDSLM-GAAVNVGVRPEDM----VEAAPG 294 N L + GA ++ GG A P +SL GA +++G+RPE + AP Sbjct: 240 NFLSATVTSAGADGLRADLAAGGAAA--LPLIESLAPGARIDIGIRPEQLSVVPAGQAPS 297 Query: 295 GDYV-FEGKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHV 353 D V G+VA+ E LG + L+ +D IG H G+ R+ A + V V Sbjct: 298 ADAVSVAGRVALIEDLGAESYLHLHL--ADDSRIGVRTARHAAHLGEEVRVAAPASGVLV 355 Query: 354 FKD 356 F + Sbjct: 356 FDE 358 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 367 Length adjustment: 30 Effective length of query: 343 Effective length of database: 337 Effective search space: 115591 Effective search space used: 115591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory