Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_011840308.1 RSPH17029_RS01585 acyl-CoA dehydrogenase
Query= BRENDA::Q92947 (438 letters) >NCBI__GCF_000015985.1:WP_011840308.1 Length = 555 Score = 135 bits (339), Expect = 4e-36 Identities = 121/391 (30%), Positives = 178/391 (45%), Gaps = 26/391 (6%) Query: 56 LEEQLTTDEILIRDTFRTYCQERLMPRILLAN-RNEVFHREIISEMGELGVLGPTI-KGY 113 L+E+L +IRD FR + ER+ P + R+E+ EI+ + E+GV G TI + + Sbjct: 171 LDEELE----MIRDQFRRFADERVAPHAHGWHMRDELIPMEIVEALAEMGVFGLTIPEEF 226 Query: 114 GCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGEL 173 G G+S + +++ EL R G S + +S + I G++ Q+ +LP+LA GE+ Sbjct: 227 GGFGLSKASMVVVSEELSRGYIGVGS-LGTRSEIAAELILCGGTDAQKAAWLPKLASGEI 285 Query: 174 LGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARC--EDG 231 L TEPN+GSD S+ TRA + + +NG KTWIT++ + + AR E Sbjct: 286 LPTAVFTEPNTGSDLGSLRTRAVKDGDE--WVVNGNKTWITHAARTHVMTLLARTDPETT 343 Query: 232 CIRG---FLLEKGMRGLSA-----PRIQGKFSLRASATGM----IIMDGVEVPEENVLPG 279 RG FL EK M G A P + G GM I DG V EN+L G Sbjct: 344 DYRGLSMFLAEK-MPGTDADPFPTPGMTGGEIEVLGYRGMKEYEIGFDGFRVKGENLLGG 402 Query: 280 ASSLGGP--FGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLA 337 G +AR A +G ++ L QYA +R QFG L + KLA Sbjct: 403 VEGQGFKQLMQTFESARIQTAARAIGVAQNALEVGMQYAEERKQFGKALIEFPRVAGKLA 462 Query: 338 DMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDE 397 M EI + KD + + K A A A + GGNG + E Sbjct: 463 MMAVEIMVARQLTYHSAWEKDHGQRCDLEAGMAKLLGARVAWAAADNALQIHGGNGFALE 522 Query: 398 YHVIRHAMNLEAVNTYEGTHDIHALILGRAI 428 Y + R + +N +EG +I A ++ R + Sbjct: 523 YQISRILCDARILNIFEGAAEIQAQVIARRL 553 Lambda K H 0.319 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 575 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 555 Length adjustment: 34 Effective length of query: 404 Effective length of database: 521 Effective search space: 210484 Effective search space used: 210484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory