Align Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 (characterized)
to candidate WP_011840662.1 RSPH17029_RS04490 purine-nucleoside phosphorylase
Query= SwissProt::P77834 (274 letters) >NCBI__GCF_000015985.1:WP_011840662.1 Length = 266 Score = 213 bits (541), Expect = 5e-60 Identities = 112/243 (46%), Positives = 156/243 (64%), Gaps = 5/243 (2%) Query: 6 IEQAAQFLKEKFPTSP-QIGLILGSGLGVLADEIEQAIKIPYSDIPNFPVSTVEGHAGQL 64 +E+ A ++ + P ++GL+LGSGLG LA+ +E + +PY ++ FP + V GH +L Sbjct: 3 VERLASLIRARAGHQPVRLGLVLGSGLGHLAEAVE-GVSLPYEELAGFPEAGVSGHQPRL 61 Query: 65 VYGQLEGATVVVMQGRFHYYEGYSFDKVTFPVRVMKALGVEQLIVTNAAGGVNESFEPGD 124 V G LEG V V GR HYYE + + P+ V+K LG E LI TNAAG + PG Sbjct: 62 VVGDLEGVRVAVFGGRAHYYESGNPAAMRVPLAVLKHLGAEALIATNAAGSLRADLPPGS 121 Query: 125 LMIISDHINNMGGNPLIGPNDSALGVRFPDMSEAYSKRLRQLAKDVANDIGLRVREGVYV 184 LM++SDHIN G NPLIG A RF M++A+ LR + A G+ + EG+Y Sbjct: 122 LMLLSDHINLSGANPLIGEPSEA---RFVPMTDAHDPGLRARLRAAAEAAGVPLGEGIYA 178 Query: 185 ANTGPAYETPAEIRMIRVMGGDAVGMSTVPEVIVARHAGMEVLGISCISNMAAGILDQPL 244 +GP++ETPAEIRM RV+G DAVGMSTVPEVI+AR G++V IS ++NM AG+ D+ + Sbjct: 179 WFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFLGLKVAAISTVTNMGAGLSDEAI 238 Query: 245 THD 247 +H+ Sbjct: 239 SHE 241 Lambda K H 0.319 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 266 Length adjustment: 25 Effective length of query: 249 Effective length of database: 241 Effective search space: 60009 Effective search space used: 60009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_011840662.1 RSPH17029_RS04490 (purine-nucleoside phosphorylase)
to HMM TIGR01698 (purine nucleotide phosphorylase (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01698.hmm # target sequence database: /tmp/gapView.4027534.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01698 [M=245] Accession: TIGR01698 Description: PUNP: purine nucleotide phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-104 334.3 5.7 2.4e-104 334.1 5.7 1.0 1 NCBI__GCF_000015985.1:WP_011840662.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000015985.1:WP_011840662.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 334.1 5.7 2.4e-104 2.4e-104 2 244 .. 21 262 .. 20 263 .. 0.99 Alignments for each domain: == domain 1 score: 334.1 bits; conditional E-value: 2.4e-104 TIGR01698 2 laivlGsGlgalvealaetvelpyaeiPGfsapavaGhagrllrvrigdrsvlvlegrthayegkdvravvvp 74 l++vlGsGlg l+ea+ e v+lpy+e+ Gf+ ++v+Gh rl+ +++ + +v+v++gr+h+ye+++ +a++vp NCBI__GCF_000015985.1:WP_011840662.1 21 LGLVLGSGLGHLAEAV-EGVSLPYEELAGFPEAGVSGHQPRLVVGDLEGVRVAVFGGRAHYYESGNPAAMRVP 92 79*************9.679***************************************************** PP TIGR01698 75 vraaraiGaelliltnaaGslreelgaGslvlladhinltarsPliGlesderfvdltdaydprlrigleela 147 ++ ++ +Gae li tnaaGslr++l++Gsl+ll+dhinl++++PliG++s++rfv +tda+dp+lr++l ++a NCBI__GCF_000015985.1:WP_011840662.1 93 LAVLKHLGAEALIATNAAGSLRADLPPGSLMLLSDHINLSGANPLIGEPSEARFVPMTDAHDPGLRARLRAAA 165 ************************************************************************* PP TIGR01698 148 ervdlplaeGvyaqfsGPsyetPaevrmarilGadlvGmstvletilarflGlevlavslvtnlaaGitgeel 220 e+ ++pl eG+ya+fsGPs+etPae+rmar+lGad+vGmstv+e+ilarflGl+v+a+s vtn+ aG++ e + NCBI__GCF_000015985.1:WP_011840662.1 166 EAAGVPLGEGIYAWFSGPSFETPAEIRMARVLGADAVGMSTVPEVILARFLGLKVAAISTVTNMGAGLSDEAI 238 ************************************************************************* PP TIGR01698 221 shaevkavaaaagtrlaalladli 244 sh+ +ka+a++++++l +ll +++ NCBI__GCF_000015985.1:WP_011840662.1 239 SHEHTKAMAPLGAAKLETLLREFL 262 ********************9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (245 nodes) Target sequences: 1 (266 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 4.73 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory