Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_011840847.1 RSPH17029_RS05935 isovaleryl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_000015985.1:WP_011840847.1 Length = 385 Score = 204 bits (519), Expect = 3e-57 Identities = 130/378 (34%), Positives = 194/378 (51%), Gaps = 7/378 (1%) Query: 12 PLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPE 71 P+ D L EE +R++ + +AQ+++ P R ++REMGE+GLLG T+PE Sbjct: 5 PMTFD--LGEEIAALRETVHAWAQERVKPMAARIDRENVFPAELWREMGELGLLGITVPE 62 Query: 72 QYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASG 131 ++GGS + Y+ + + EV R + S+L + I G+ QK +YLPKL SG Sbjct: 63 EFGGSDMGYLAHTVAVEEVARASASVSLSYGAHSNLCVNQIRLNGSPEQKARYLPKLVSG 122 Query: 132 EWIGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD---- 187 E +G ++E GSD SM +A K +G Y L G+K WITN P ADV VV+AK D Sbjct: 123 EHVGALAMSEAGAGSDVVSMKLKAEKRNGYYVLNGTKYWITNGPDADVLVVYAKTDPEAG 182 Query: 188 AGDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIF-PDVRGLKGPFT 246 A I F++EK G S KVG+R S TGE++ +N VP EN+ D +G++ + Sbjct: 183 AKGITAFLIEKSMTGFSTSPHFDKVGMRGSNTGELIFENCEVPFENVLGQDGKGVRVLMS 242 Query: 247 CLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQ 306 L+ R +S G AC Y RQQFG+P+ QL+Q KLADM + A Sbjct: 243 GLDYERVVLSGIGTGIMAACLDEVVPYCQSRQQFGQPIGNFQLMQGKLADMYVALNTARA 302 Query: 307 GCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLE 366 R D G + + +A+ A A LGG G ++ V+R + + Sbjct: 303 YVYETARACDAGRVTRADAAGCVLYASEQAMVQAHQAVQALGGAGYLNDSVVSRLFRDAK 362 Query: 367 VVNTYEGTHDVHALILGR 384 ++ GT ++ +++GR Sbjct: 363 LMEIGAGTSEIRRMLIGR 380 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 385 Length adjustment: 30 Effective length of query: 363 Effective length of database: 355 Effective search space: 128865 Effective search space used: 128865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory