Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_011840924.1 RSPH17029_RS06550 enoyl-CoA hydratase/isomerase family protein
Query= curated2:P24162 (257 letters) >NCBI__GCF_000015985.1:WP_011840924.1 Length = 258 Score = 327 bits (837), Expect = 2e-94 Identities = 170/258 (65%), Positives = 196/258 (75%), Gaps = 1/258 (0%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGEARAIVLTGSGRAFC 60 M Y TIR E GL +TL RPEVMNAL++ MR EL A+ A ARA+VLTG GR FC Sbjct: 1 MDYRTIRVEEQGGLCRVTLARPEVMNALSSRMREELLHAVTEAGTRARALVLTGEGRGFC 60 Query: 61 SGQDLGDGAAEGL-NLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVV 119 SGQDLGD A G+ + E +LREEYEPLL+AI CPLP LAAVNG AAGAGANLALA DVV Sbjct: 61 SGQDLGDARALGVPDFERILREEYEPLLRAIAHCPLPTLAAVNGVAAGAGANLALACDVV 120 Query: 120 IAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEA 179 IAA+SA F+QAFTRIGL+PD GGTW LPRQ+G+ARAMG LFA++I A +AAR G+I+EA Sbjct: 121 IAAESAGFIQAFTRIGLIPDTGGTWTLPRQIGLARAMGATLFADRISAADAARWGMIYEA 180 Query: 180 VPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADF 239 VPD FE W+ARAAHLA GP+ A+ +K+A A N QLALEARLQG+ G SADF Sbjct: 181 VPDEAFEARWQARAAHLAEGPTEAYRGLKQALRASFDNSFEEQLALEARLQGQCGASADF 240 Query: 240 REGVQAFLEKRPPHFTGR 257 EGV AFLEKRP F+GR Sbjct: 241 LEGVTAFLEKRPATFSGR 258 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 258 Length adjustment: 24 Effective length of query: 233 Effective length of database: 234 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory