Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_011840924.1 RSPH17029_RS06550 enoyl-CoA hydratase/isomerase family protein
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_000015985.1:WP_011840924.1 Length = 258 Score = 95.5 bits (236), Expect = 1e-24 Identities = 76/256 (29%), Positives = 116/256 (45%), Gaps = 6/256 (2%) Query: 7 TSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAG 66 T R E +TL+ P NAL M + A+ E RA+V+TG FC+G Sbjct: 5 TIRVEEQGGLCRVTLARPEVMNALSSRMREELLHAV--TEAGTRARALVLTGEGRGFCSG 62 Query: 67 GNLNRLLENRAKD-PSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDL 125 +L + RA P + + + A+ P +AAV+G AAGAG +LALACD+ Sbjct: 63 QDLG---DARALGVPDFERILREEYEPLLRAIAHCPLPTLAAVNGVAAGAGANLALACDV 119 Query: 126 IVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNK 185 ++AA+ A F+ ++ R+GL PD GG+W L + + A + I AA G++ + Sbjct: 120 VIAAESAGFIQAFTRIGLIPDTGGTWTLPRQIGLARAMGATLFADRISAADAARWGMIYE 179 Query: 186 LTKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHRE 245 A A L + + +K + A+ E L E + Sbjct: 180 AVPDEAFEARWQARAAHLAEGPTEAYRGLKQALRASFDNSFEEQLALEARLQGQCGASAD 239 Query: 246 GLEGISAFLEKRAPVY 261 LEG++AFLEKR + Sbjct: 240 FLEGVTAFLEKRPATF 255 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 258 Length adjustment: 24 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory