Align GlpQ, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_011840944.1 RSPH17029_RS06705 carbohydrate ABC transporter permease
Query= TCDB::G3LHZ1 (273 letters) >NCBI__GCF_000015985.1:WP_011840944.1 Length = 267 Score = 449 bits (1154), Expect = e-131 Identities = 213/262 (81%), Positives = 239/262 (91%) Query: 12 SWLVPTIYIIFLILPIYWLINMSFKENSEITGAFSLWPTNPTLRNYTVIFTDPSWYNGYI 71 S LV +Y++FL++PIYWL+NMSFK N+EIT +F+L+P + T +NY I TDPSWY GY+ Sbjct: 6 STLVMVLYLLFLLIPIYWLVNMSFKTNAEITRSFTLFPHDLTFQNYRTILTDPSWYMGYV 65 Query: 72 NSIIYVVMNTVISVAAALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFALPFFQLYSA 131 NS+ YVV+NT IS+ ALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFALPFFQLYS+ Sbjct: 66 NSLTYVVLNTAISITVALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFALPFFQLYSS 125 Query: 132 FGLIDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPRFFIKIFIPLI 191 GL DTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPRFF+KIF+PLI Sbjct: 126 VGLFDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPRFFVKIFMPLI 185 Query: 192 ASGVGVAGFFCFMFSWVELLLARTLTTTAAKPISAIMTRTVSASGMDWGVLAAAGVLTII 251 ASG+GVA FFCFMFSWVELLL+RTLT+ AKPI+A MTRTVSASG+DWGVLAAAGVLT+I Sbjct: 186 ASGIGVAAFFCFMFSWVELLLSRTLTSVNAKPIAATMTRTVSASGLDWGVLAAAGVLTLI 245 Query: 252 PGALVIYFVRNYIAKGFALGRV 273 PG LVI+FVRNYIAKGFALGRV Sbjct: 246 PGGLVIWFVRNYIAKGFALGRV 267 Lambda K H 0.330 0.142 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 267 Length adjustment: 25 Effective length of query: 248 Effective length of database: 242 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory