Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_011840945.1 RSPH17029_RS06715 ABC transporter ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >NCBI__GCF_000015985.1:WP_011840945.1 Length = 361 Score = 436 bits (1121), Expect = e-127 Identities = 218/355 (61%), Positives = 269/355 (75%), Gaps = 6/355 (1%) Query: 1 MARITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQ 60 M+RITL ++ H+Y PK+ DY+LKE+DH W DGGAYALLG SGCGKTTLLNIISGLL+ Sbjct: 1 MSRITLSNLAHSYLPKPKAPADYALKEMDHVWQDGGAYALLGASGCGKTTLLNIISGLLR 60 Query: 61 PSHGRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRV 120 PS GR+LF DVT+ T +RNIAQVFQFPV+YDTMTV +NLAFPLRNRG A + RV Sbjct: 61 PSQGRVLFGETDVTDAPTAARNIAQVFQFPVVYDTMTVRENLAFPLRNRGRDAAYIAARV 120 Query: 121 RDILEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLR 180 I MI + + KA+GLTAD KQKISLGRG+VR DVNAILFDEPLTVIDPHMKW LR Sbjct: 121 EQIAAMIGMEAMLSSKARGLTADAKQKISLGRGMVREDVNAILFDEPLTVIDPHMKWELR 180 Query: 181 SQLKRLHKQFGFTMVYVTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYF 240 +QLK+LH++FG TM+YVTHDQTEALTFA+KVVVM++G++VQ GTP ELFE P HTFVGYF Sbjct: 181 TQLKQLHREFGHTMIYVTHDQTEALTFADKVVVMHEGRVVQTGTPEELFETPEHTFVGYF 240 Query: 241 IGSPGMNFMPARIEGSTVKVGDETLTLEYAPKTSGTAKTELGIRPEFIRLGREGMPITIS 300 IGSPGMN + A +EG +V + L A + + ++GIRPEF++L EG+P I+ Sbjct: 241 IGSPGMNLLEAEVEGPMARVMGHPVPLS-ASYPAARGRVQIGIRPEFVQLADEGLPAIIT 299 Query: 301 KVEDIGRQKIVRARFADQPIAIVVPEDADIPA---DARVTFDPSAISIYADSWRV 352 +VED+GR +I+R QP+ +++PE DIPA A + P I++YAD WRV Sbjct: 300 RVEDVGRHRILRGEAFGQPVNLLLPE--DIPAATGPAFLRLAPEKINVYADDWRV 352 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 361 Length adjustment: 29 Effective length of query: 327 Effective length of database: 332 Effective search space: 108564 Effective search space used: 108564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory