Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_011841069.1 RSPH17029_RS07670 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >NCBI__GCF_000015985.1:WP_011841069.1 Length = 369 Score = 349 bits (895), Expect = e-101 Identities = 195/370 (52%), Positives = 235/370 (63%), Gaps = 2/370 (0%) Query: 1 MASVTLRNIRKAYDENEVMRDINLDIADGEFVVFVGPSGCGKSTLMRMIAGLEDISGGDL 60 MA + L + KAY E V+RDI+L I GE +VFVGPSGCGKSTL+RMIAGLE I+GG L Sbjct: 1 MADLKLTGVEKAYGEVRVLRDIDLTIEKGELIVFVGPSGCGKSTLLRMIAGLERITGGTL 60 Query: 61 TIDGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDAAVRNAAKI 120 IDG VNDV PA+RGIAMVFQSYALYPHMT+ NM F LK+AG K EI AV NAA+I Sbjct: 61 EIDGQVVNDVPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAGQSKAEIARAVENAARI 120 Query: 121 LHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKMRLEFARLH 180 L + LDR P+ LSGGQRQRVAIGRAI R PKV+LFDEPLSNLDAALRV R+E A+L Sbjct: 121 LQLTPYLDRLPRALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLK 180 Query: 181 DEL-KTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAGFIGSPKM 239 +++ TMIYVTHDQVEAMTLA +IVVL G + QVG+P LY P N FVA FIGSP M Sbjct: 181 EKMPDRTMIYVTHDQVEAMTLASRIVVLEGGGISQVGTPLELYTRPRNAFVARFIGSPAM 240 Query: 240 NFMEGVVQSVTHDGVTVRYETGETQRVAVEPAAVKQGDKVTVGIRPEHLHVGMAEDGISA 299 N + G + T VR ++G R A+ G V +G+RPE L Sbjct: 241 NLLPGEIVE-TGPETVVRLDSGGVARTAIPTEPEDLGLLVDLGVRPEDLVKTDGPPLYEG 299 Query: 300 RTMAVESLGDAAYLYAESSVAPDGLIARIPPLERHTKGETQKLGATPEHCHLFDSAGKAF 359 E+LG+ LY ++A++P ++ + T +LGA P HLF Sbjct: 300 EVEITEALGEVTLLYFVPRDEGGQVVAKLPGIQADLRHRTVRLGADPARLHLFHEGQSLL 359 Query: 360 QRKIVEVLAA 369 R E+ A Sbjct: 360 YRDRTELARA 369 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 369 Length adjustment: 30 Effective length of query: 339 Effective length of database: 339 Effective search space: 114921 Effective search space used: 114921 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory