Align Glucokinase; EC 2.7.1.2 (characterized, see rationale)
to candidate WP_011841074.1 RSPH17029_RS07695 glucokinase
Query= uniprot:A8LLL9 (323 letters) >NCBI__GCF_000015985.1:WP_011841074.1 Length = 317 Score = 341 bits (874), Expect = 2e-98 Identities = 186/315 (59%), Positives = 219/315 (69%), Gaps = 2/315 (0%) Query: 4 LRDAP-ALVADIGGTNTRVALADGPVLRAGSVEKYRNADYSSLDSVLRSYLEKMEVAGCS 62 + DAP LVADIGGTNTRVALA+G LR + ++RNADY +L VLR +L Sbjct: 1 MADAPLCLVADIGGTNTRVALAEGSRLRPETTRRFRNADYPALAPVLRDFLSVAGSPEID 60 Query: 63 GACVALAGPVRNGIGHLTNLDWRMDEDLLSEATGAPVVALLNDLQAQGFALGHLEAACLR 122 G CVA AGPVR+G+ LTNL W +D L ATGAP VA+LNDLQAQG ALGHL+ A L Sbjct: 61 GTCVAAAGPVRDGVALLTNLAWTVDGAELQRATGAPRVAVLNDLQAQGHALGHLDPANLH 120 Query: 123 PVISRPPPAAQETRLMIGLGTGFNAASVLYTPAGRIVTPSEAGHANLPVRTEQELRLCRF 182 +I P P L++G+GTGFNAA V R+V SE GHA +PVRT ++LRL F Sbjct: 121 VLIPGPTPRRAGPMLVVGVGTGFNAAPVHDVAGLRLVAASECGHAGMPVRTARDLRLAEF 180 Query: 183 VETAHGFPAVEDVLSGRGLERVYNFLSPTPDQPQRLSAAEVMAAAAREERQALDALELFI 242 V+TAHGF VEDVLSGRGLER+Y F + R SAAE+MAA A E A A ELF Sbjct: 181 VQTAHGFAGVEDVLSGRGLERLYAFTAAEAGLEDRKSAAEIMAAIA-EPGPARAAAELFA 239 Query: 243 GLLGTVAGNLSLIHLPFGGVYLCGGVARHIGPYLGSMGFAEAFANKGRFADFMRDFPVWL 302 LLG AGNL+LIHLPFGG+YLCGGVAR +LG MGFAE F +KGRF+ FM DFPV + Sbjct: 240 RLLGAEAGNLALIHLPFGGLYLCGGVARAFAAHLGPMGFAENFRDKGRFSAFMDDFPVCI 299 Query: 303 VEDDFAALTGCASFL 317 VEDD+AALTGCA++L Sbjct: 300 VEDDYAALTGCAAYL 314 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 317 Length adjustment: 28 Effective length of query: 295 Effective length of database: 289 Effective search space: 85255 Effective search space used: 85255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory