Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_011841104.1 RSPH17029_RS07950 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_000015985.1:WP_011841104.1 Length = 431 Score = 107 bits (268), Expect = 5e-28 Identities = 92/343 (26%), Positives = 147/343 (42%), Gaps = 53/343 (15%) Query: 110 GTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYA-----------IGAYTFALLNH 158 G I ++ + G V L +L+ GGF+A I A AL + Sbjct: 95 GAATIGAAVAVWRRMAKGWARTVALLAVLI---GGFFAYRAIFDPAVAAIEAINPALYGN 151 Query: 159 YYGLGFWTCL--PIAGLMAAAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEIT 216 GLG L P GL+AA A + +G L LR DYLAI TLG EI+ ++ N + Sbjct: 152 IGGLGLPVLLAWPAGGLLAALAAWAIGKTALGLRSDYLAIATLGIAEIIIAVMKNEDWLA 211 Query: 217 GGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDP---SDRVIFLYLVALLLVV 273 G + +P+P + ++ ++A W G YDP S V+ L AL + V Sbjct: 212 RGVKNMISLPRPVPYEVDLQQSAGFVAWAQ-----GWGYDPVTASAIVVKLCYAALFVAV 266 Query: 274 LSLFVI--NRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFAGFAGTLFA 331 L++ V LR P GR A+R++E+A ++G R L F + AA G AG + Sbjct: 267 LAIIVTLSELALRSPWGRMMRAIRDNEVAAEAMGKDVTRRHLQIFVLGAAVIGIAGAMMT 326 Query: 332 ARQGFVSPESFTFAESAF-VLAIVVLGGMGSQFAVILAAILL------------------ 372 ++P ++ F V +V++GG GS + +L L+ Sbjct: 327 TLDSQLTPGTYNPLRFTFLVWVMVIVGGSGSNWGAVLGGFLIWWLWVMVEPIGLSLLGAI 386 Query: 373 --------VVSRELMRDFNEYSMLMLGGLMVLMMIWRPQGLLP 407 + L +L +G +++L++ + P+GL+P Sbjct: 387 TAGMADGSWLKAHLQDSAAHMRLLTMGLILLLVLRFSPRGLIP 429 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 431 Length adjustment: 32 Effective length of query: 393 Effective length of database: 399 Effective search space: 156807 Effective search space used: 156807 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory