Align ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale)
to candidate WP_011841384.1 RSPH17029_RS10180 ABC transporter permease subunit
Query= uniprot:A0A1N7U128 (237 letters) >NCBI__GCF_000015985.1:WP_011841384.1 Length = 275 Score = 127 bits (320), Expect = 2e-34 Identities = 80/224 (35%), Positives = 118/224 (52%), Gaps = 18/224 (8%) Query: 21 SGVAMTLWLFIISVVLGFFLSIPLALARVSEHVWLRWPVEVYTYLFRGTPLYIQLLICYT 80 SG+ ++ ++++ GFFL+ LA+A+ + ++R P E + +LFRG+PL+IQ I Y Sbjct: 38 SGMIWNIYFGVLALAAGFFLANALAVAKAAPSPFVRKPAEWFIFLFRGSPLFIQFFIAYQ 97 Query: 81 GLYSLE--------IVQDNALLNQFFRNALNCTLLAFVLNTCAYTVEIFAGAIRNIPHGE 132 L L I + A L + + AL + NT AY+ EIF GA+ IP G+ Sbjct: 98 ALVMLPRAGIDLWGITVETAWLTRAWAGAL----IVLFFNTAAYSAEIFHGALMAIPKGD 153 Query: 133 IEAARAYGLHGWRLNLFVVVPAALRRALPAYSNEMILMLHATSLAFTATV------ADIL 186 +EAA AYGL GW+ + P LR A PAY+NE I + HAT+L F + D L Sbjct: 154 LEAADAYGLSGWKKFRRIQWPTMLRLAWPAYTNEAIFLFHATTLVFFSGFPAFQQRGDAL 213 Query: 187 KVARDANAETFLTFQAFGIAALLYMLLSFALVGLFRLAERRWMR 230 A +TF F + I A ++ L+ ++ LF L RR R Sbjct: 214 YYANYFADKTFNPFVPYPIVAFYFICLTLLVIWLFGLMNRRLNR 257 Lambda K H 0.332 0.143 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 275 Length adjustment: 24 Effective length of query: 213 Effective length of database: 251 Effective search space: 53463 Effective search space used: 53463 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory