Align TRAP-type periplasmic solute-binding protein (characterized, see rationale)
to candidate WP_011841463.1 RSPH17029_RS10770 TRAP transporter substrate-binding protein
Query= uniprot:Q930R1 (334 letters) >NCBI__GCF_000015985.1:WP_011841463.1 Length = 325 Score = 189 bits (480), Expect = 8e-53 Identities = 112/313 (35%), Positives = 173/313 (55%), Gaps = 5/313 (1%) Query: 1 MRKLLLATTAIAFGLSAAAPAFAEFNDRNIRVSNGINEDHPVGNGIKAMQACLDQKSGGK 60 M+K ++AT + L AAPAFAE + +R S+ + +P G+K M + S G+ Sbjct: 1 MKKTMIATLLASAAL--AAPAFAEC-EVTLRSSDTHPDGYPTVEGVKFMAERAKELSNGR 57 Query: 61 LKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGIIPALGVFDLPFLFANAQEAYT 120 + + F LG + + + GV + V S I+P + LP+LF + + + Sbjct: 58 ICIEVFPSSQLGEEKDTIEQTQFGVIDMVRASFGSFNDIVPEAQLLSLPYLFRSEEHLHN 117 Query: 121 VLDGDFGDMMNEKLEAAGLVNLAYWENGFRNLSNSVRPVTKWEDFEGMKVRVMQNNIFLD 180 V+DG GD + + EA L+ +AY++ G R+ NS +P+TK ED +GMK RVMQ+++F+D Sbjct: 118 VMDGPIGDELAKAFEAKDLIAVAYYDGGSRSFYNSQKPITKVEDLKGMKFRVMQSDVFVD 177 Query: 181 TFQNLGANATPMAFGEVFSALETKAIDAQENPYVTIDTSKFFEVQKYVTETNHAYTPFLF 240 LGANATPM +GEV+S+++T ID EN + + D+S FEV KY T H P L Sbjct: 178 MMSALGANATPMPYGEVYSSIQTGVIDGAENNWPSYDSSGHFEVAKYYTLDQHLMVPELV 237 Query: 241 LFSKPIFDSYTPEEQAALRECAVVGRDEERKVIQDLNKKSLEKIKEAGLEVNTLSAEEQA 300 SK +D+ +PE+Q LR+ A +RK+ + K S EK+ +G EV + ++ Sbjct: 238 AISKIKWDALSPEDQQVLRQAAEESEPVQRKLWAEQEKASEEKVVASGAEV--VREIDKT 295 Query: 301 RIREKSMVVYEKH 313 E VYEK+ Sbjct: 296 PFIEAMAPVYEKY 308 Lambda K H 0.317 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 325 Length adjustment: 28 Effective length of query: 306 Effective length of database: 297 Effective search space: 90882 Effective search space used: 90882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory