Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_011841563.1 RSPH17029_RS11495 carbon-nitrogen hydrolase family protein
Query= BRENDA::B3IVI7 (264 letters) >NCBI__GCF_000015985.1:WP_011841563.1 Length = 291 Score = 64.3 bits (155), Expect = 3e-15 Identities = 64/209 (30%), Positives = 103/209 (49%), Gaps = 26/209 (12%) Query: 29 AAERGAQLLVCPEMFLTGYNIGLAQVERLAEAADGPAAMTVVEI------AQAHRIAIVY 82 AA +GA LLV PE + LA + A AAD AA+ V A R+A + Sbjct: 30 AAGQGADLLVFPEYGA----MELASLGGRAVAADLEAALHEVARHGPAVGALLTRLAAAH 85 Query: 83 GYPERGDDGAIYNSVQLIDA---HGRS-LSNYRKTHLFGELDRSMFS--PGADHFPVVEL 136 G G ++ + ++ +G + + ++ + +R ++ PG++ V E Sbjct: 86 GVHILGPSAPVFEGPRPVNRAVLYGPAGVIGHQDKLIMTRFEREIWDVVPGSEA-RVFET 144 Query: 137 EGWKVGLLICYDIEFPENARRLALDGAELILVPTANMTPYDFT-CQVTVRARAQENQCYL 195 ++G++ICYD EFP AR + GAE++L P+ + FT +V ARA ENQC + Sbjct: 145 ALGRIGIVICYDSEFPLLARAMVEQGAEILLAPSCTDSLAGFTRVRVGAMARALENQCVV 204 Query: 196 VYA------NYCGAEDEIEYCGQSSIIGP 218 V+A ++C A D E G+++I GP Sbjct: 205 VHAPTVGLCDFCPAVD--ENVGRAAIYGP 231 Lambda K H 0.322 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 291 Length adjustment: 25 Effective length of query: 239 Effective length of database: 266 Effective search space: 63574 Effective search space used: 63574 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory