Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate WP_011841821.1 RSPH17029_RS13515 FAD-binding protein
Query= reanno::Phaeo:GFF2924 (366 letters) >NCBI__GCF_000015985.1:WP_011841821.1 Length = 358 Score = 392 bits (1008), Expect = e-114 Identities = 215/367 (58%), Positives = 257/367 (70%), Gaps = 12/367 (3%) Query: 1 MTPQSEAELAQIIVGATAPLAVSGGGTRGLS-TGGETLSVAGLNGVTLYEPGALTLVVQA 59 M P +E ELA+I+ GA PL + GGGTR + T G L AGL GV LYEPGALTLV A Sbjct: 1 MRPSTEEELAEIVRGAAGPLRIRGGGTRAIGRTDGAPLETAGLAGVRLYEPGALTLVAGA 60 Query: 60 GTSVEEVQALLAGENQRLAFEPMDHRGLLGTKGTPTIGGVFAANVSGPRRIQCGAARDFL 119 G+ + E++A+LA E QRL FE D RGLLG +G T+GGV AAN SGPRRIQ GA RD L Sbjct: 61 GSPLGEIEAMLAAEGQRLPFEAPDLRGLLGREGVSTLGGVVAANGSGPRRIQAGACRDSL 120 Query: 120 LGVRFVDGRGDVLSNGGRVMKNVTGYDLVKLMAGSHGTLGVLSEVSLKVLPCSEACATVT 179 +GVRFVDG G V+ NGGRVMKNVTGYDLVKLMAGSHGTLGVLSEV+ K+LP E T+ Sbjct: 121 IGVRFVDGAGQVVKNGGRVMKNVTGYDLVKLMAGSHGTLGVLSEVAFKLLPLPETELTLA 180 Query: 180 VHVADLTSAVAAMSTALGSPYDVTGAAYDPEAGAVYIRVEGFEASVTYRAEALKMALGKF 239 + AV AM+ ALGSP+DV+GAA+ P G ++R+EGFEASV YRAE L+ L F Sbjct: 181 LPDLAPERAVEAMAAALGSPFDVSGAAHWPGRG-TFLRIEGFEASVRYRAERLRRLLTGF 239 Query: 240 GEVSLALGAGDALWEGIRNVAAFHDRPGDVWRISVKPSDAVALAPALEAEGLLFDWGGGL 299 GE + ++ W IR+VA FH R GDVWR+S+KPS+A A+A A LFDWGGGL Sbjct: 240 GEAAEV----ESPWAAIRDVAPFHGREGDVWRLSLKPSEAPAVA-ARAGGAALFDWGGGL 294 Query: 300 IWALVPAGRDLRFRLT-VPGHATLVRASAQTRAELGQFQPQPGPLAAISGGLRRQFDPRG 358 +W L G DLR R+ GHATLVR +A A F P+P PLAA++ GLR +FDPRG Sbjct: 295 VWILTEPGTDLRARIAPFAGHATLVRGTAPVAA----FHPEPLPLAALAAGLRARFDPRG 350 Query: 359 ILNPGLM 365 + NPGLM Sbjct: 351 LFNPGLM 357 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 26 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 358 Length adjustment: 29 Effective length of query: 337 Effective length of database: 329 Effective search space: 110873 Effective search space used: 110873 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory