Align hexokinase (EC 2.7.1.1) (characterized)
to candidate WP_011841916.1 RSPH17029_RS14335 ROK family protein
Query= BRENDA::Q5SLJ4 (302 letters) >NCBI__GCF_000015985.1:WP_011841916.1 Length = 425 Score = 121 bits (304), Expect = 2e-32 Identities = 84/258 (32%), Positives = 130/258 (50%), Gaps = 15/258 (5%) Query: 2 KVVGLDLGGTKIAAGVFD--GKRLLSKVVVPTPKE-GGERVAEALAEAAERAEREAGVRG 58 +VVGL + ++A V D G L +P ER+ + +R +AG+ Sbjct: 102 RVVGLKISDRDLSAVVMDFAGHLLAEHHEERSPAALPPERILGLIETLLDRVTTKAGLTR 161 Query: 59 E---AIGLGTPGPLDFRRGVIRFAPNIPGVQDFPIRRILEEATGRPVFLENDANAAALAE 115 + A+G+G PG +D G + ++ +I ++ P+ R++ E G P ++NDAN A+AE Sbjct: 162 QELSAVGIGLPGYVDSAGGRVLWS-SILSERNVPLGRLVTERLGLPAQIDNDANLCAMAE 220 Query: 116 HHLGAAQGEESSLYLTVSTGIGGGVVLGGRVLRGERGQGGELGHLTLLPGGPACGCGLEG 175 GA + + +T+ G+G G+V R+ RG RG G ELGH + G C CG G Sbjct: 221 LWFGAGRRLSDFVVVTIEHGLGMGMVTNHRIFRGARGIGMELGHTKVQLDGALCRCGQRG 280 Query: 176 CLEALAAGRALERDATYAFQ--------RPVDTRELFRLFQAGDPKAERLVLQAARYVGI 227 CLEA A AL R+AT A V L +AG+ A + +A RY+ + Sbjct: 281 CLEAYVADYALAREATTALNWTHRQTQSTAVLLESLHDHAKAGNQAARSIFRRAGRYLAV 340 Query: 228 GLASLVKAFDPGVVVLGG 245 GLA++V DP +++L G Sbjct: 341 GLANVVNLVDPPLLILAG 358 Lambda K H 0.318 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 425 Length adjustment: 29 Effective length of query: 273 Effective length of database: 396 Effective search space: 108108 Effective search space used: 108108 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory