Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate WP_011841924.1 RSPH17029_RS14390 carbon-nitrogen hydrolase family protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_4777 (264 letters) >NCBI__GCF_000015985.1:WP_011841924.1 Length = 276 Score = 71.6 bits (174), Expect = 2e-17 Identities = 82/275 (29%), Positives = 116/275 (42%), Gaps = 26/275 (9%) Query: 1 MRVALYQCPPLPLDPAGNLHRL--HQVALEARGADVLVLPEMFMTGYNIGVDAVNVLAEV 58 MR AL Q DP NL H A A GA+ ++ PE + +L Sbjct: 1 MRAALVQLTVTD-DPEENLAVTLGHVRAAAAAGAEFVLTPECTNALSSSREHQRRILRHE 59 Query: 59 YNGEWAQQIARIAKAAGLAIVYG---YPERGEDGQIYNAVQLIDAQGERLANYRKSHLFG 115 + A AG+ ++ G DG+ N LI G A Y K H+F Sbjct: 60 EEDAALAALREEAARAGIWLLVGSLGLRTHEADGRFANRSFLIGPDGAVAARYDKIHMFD 119 Query: 116 D--------LDHAMFSAGDAALPIVELNGWKLGLLICYDLEFPENARRLALAGAELILVP 167 + A++ G AA+ + + +G+ +CYDL FP RRLA AGA+++ VP Sbjct: 120 VNVSETEVYRESAVYRPGGAAV-LAQAGEAAVGMTVCYDLRFPHLYRRLAQAGAQILTVP 178 Query: 168 TA-NMQPYEFIADVTVRARAIENQCFVAYANYCGHEGEL-----QYCGQSSIAAPNGSRP 221 A N +V +RARAIE CFV G E + G S AP G Sbjct: 179 AAFNHLTGAAHWEVLLRARAIETGCFVLAPAQTGFHAEAHGKGRRTHGHSLAVAPWGEIL 238 Query: 222 ALAGLDEALIVAELDRQLMDDSRAAY---NYLHDR 253 A AG + + + +LD L + +RA + + HDR Sbjct: 239 ADAGTEPGVTLVDLD--LAEVARARHRVPSLGHDR 271 Lambda K H 0.321 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 276 Length adjustment: 25 Effective length of query: 239 Effective length of database: 251 Effective search space: 59989 Effective search space used: 59989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory