Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011841981.1 RSPH17029_RS14870 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >NCBI__GCF_000015985.1:WP_011841981.1 Length = 310 Score = 105 bits (262), Expect = 2e-27 Identities = 93/326 (28%), Positives = 136/326 (41%), Gaps = 31/326 (9%) Query: 115 LLLYPMVVVAIKGPQGSL-TYVDNFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVG 173 L L+ V+ I Q L Y +IL+ A G NI G GLL LG+ F+A G Sbjct: 4 LALHLAVLAGIAALQFVLPAYHHTNAARILVLATYAIGFNIAFGYTGLLSLGHALFFAGG 63 Query: 174 AYSYALLSSYFGLSFWVLLPLSGIFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVL 233 Y+ LL G W L + + +G LR G IVTL F + L + Sbjct: 64 MYATGLLVDQGGWQPWAALLAGPVAGGVLAAGVGLLALRTAGPAFMIVTLMFAQAFHLAI 123 Query: 234 INWTDVTKGTFGISSIPKATLFGIPFDATAGGFAKLFHLPISSAYYKIFLFYLILALCML 293 + W T G G + A G PFD ++ + +L+ A +L Sbjct: 124 LYWGRFTGGDEGFTLSGAARRIG-PFD-------------LADPTTRYGAAFLLFAAALL 169 Query: 294 TAYVTIRLRRMPIGRAWEALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQ 353 +R R GR A+RE+E R LG +T TKL A A + +G AG+ + Sbjct: 170 GCLALVRSR---TGRVLIAVRENEERTRMLGYDTFRTKLLALALSGLLSGAAGATYGLMF 226 Query: 354 GFVSPESFVFLESAVILAIVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFT 413 G+V S + L V+LGG G++ G + GT LL F + + T Sbjct: 227 GYVGGSFAAIQYSILPLIWVLLGGAGTVLGPLL-------GTALL----FYLIDWASSIT 275 Query: 414 PELYRMLIFGLAMVVVMLFKPRGFVG 439 + G +++++LF PRG +G Sbjct: 276 TA--SQFVVGAVLILLVLFAPRGLLG 299 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 310 Length adjustment: 30 Effective length of query: 433 Effective length of database: 280 Effective search space: 121240 Effective search space used: 121240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory