Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_011841987.1 RSPH17029_RS14905 acyl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_000015985.1:WP_011841987.1 Length = 403 Score = 540 bits (1390), Expect = e-158 Identities = 271/389 (69%), Positives = 314/389 (80%), Gaps = 2/389 (0%) Query: 7 FNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLG 66 F+W DP ++ QL+EEERM+RD A +AQ++L PRV A+R EQTDPAIFREMGE+GLLG Sbjct: 15 FDWEDPFRMELQLSEEERMLRDGARAYAQERLMPRVTAAYREEQTDPAIFREMGEMGLLG 74 Query: 67 ATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLP 126 AT+PE+YGG G +YV YGLIARE+ER+DSGYRSMMSVQSSLVM PI +G+E Q+++YLP Sbjct: 75 ATVPEEYGGLGASYVSYGLIAREIERVDSGYRSMMSVQSSLVMYPIYAYGSEDQRRRYLP 134 Query: 127 KLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKD 186 LA GE IGCFGLTEP+ GSDP M T ARK GY L+GSKMWI+N+PIADVFVVWAK Sbjct: 135 GLAKGELIGCFGLTEPDAGSDPAGMKTVARKTAEGYVLSGSKMWISNAPIADVFVVWAKS 194 Query: 187 DA--GDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGLKGP 244 +A G IRGFVLEKG +GLSAP I GK+ LRASITGEIVM+ V V EE + P V GLKGP Sbjct: 195 EAHGGKIRGFVLEKGMKGLSAPKIGGKLSLRASITGEIVMEGVEVGEEALLPGVEGLKGP 254 Query: 245 FTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLA 304 F CLN ARYGISWG LGAAEAC H ARQY LDR+QFGRPLA QL Q KLA+M T+I L Sbjct: 255 FGCLNRARYGISWGVLGAAEACLHAARQYGLDRRQFGRPLAQTQLYQLKLANMMTDIALG 314 Query: 305 LQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVN 364 Q LR+GR+ DE AA E+ SI+KR++CGKAL+ AR ARDM GGNGI +EF V RH+ N Sbjct: 315 AQASLRVGRLLDEANAAPEMISIVKRSNCGKALEAARHARDMHGGNGIQEEFHVMRHMAN 374 Query: 365 LEVVNTYEGTHDVHALILGRAQTGIQAFY 393 LE VNTYEGTHDVHALILGRA TG+QAF+ Sbjct: 375 LETVNTYEGTHDVHALILGRAITGLQAFF 403 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 403 Length adjustment: 31 Effective length of query: 362 Effective length of database: 372 Effective search space: 134664 Effective search space used: 134664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory