Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate WP_011842041.1 RSPH17029_RS15320 ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >NCBI__GCF_000015985.1:WP_011842041.1 Length = 372 Score = 267 bits (682), Expect = 4e-76 Identities = 153/323 (47%), Positives = 200/323 (61%), Gaps = 10/323 (3%) Query: 20 LAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLDNE 79 L+ + F +VIP L L++ GE + LGPSGCGKTT LR+IAGL GRI + Sbjct: 24 LSEVGMTFGTLDVIPSLSLSVRRGEMVAFLGPSGCGKTTTLRMIAGLLDPTRGRISVGGR 83 Query: 80 DITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQLET 139 +ITH+P +R + VFQSYALFPHMTV +NVAFGL M++ AEI RV AL MVQL Sbjct: 84 EITHLPVHDRDMGMVFQSYALFPHMTVAQNVAFGLEMRRMAKAEIRSRVERALAMVQLGH 143 Query: 140 FAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKLGI 199 A RKP LSGGQQQRVA+ARA+V +P +LLLDE LS LD KLR +M+ ++++LQ++ GI Sbjct: 144 LAGRKPKALSGGQQQRVALARALVVEPSILLLDEPLSNLDAKLRDEMRVQIRSLQQQSGI 203 Query: 200 TFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNATVI 259 T VFVTHDQ EAL+M DRIVVMR G +EQ GTP EIYE P FVA F+G N + V Sbjct: 204 TAVFVTHDQVEALSMCDRIVVMRGGHVEQFGTPNEIYERPATPFVASFVGRTNRLSGRV- 262 Query: 260 ERLDEQRVRANVEGRECNIYVNFAVEPGQKLHVLLRPEDLRVEEINDDNHA--EGLIGYV 317 + R +EGR P + VL+RP + + +D A L G + Sbjct: 263 ----DPSGRLLIEGRPVAAEGQL---PQGAVEVLVRPHRMSLRAAAEDQPAGLNSLPGVL 315 Query: 318 RERNYKGMTLESVVELENGKMVM 340 + G +++ V + G++ + Sbjct: 316 TGATFVGDLIQATVRIGGGEITV 338 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 372 Length adjustment: 30 Effective length of query: 348 Effective length of database: 342 Effective search space: 119016 Effective search space used: 119016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory