Align TRAP dicarboxylate transport system, small permease component (DctQ-like) (characterized, see rationale)
to candidate WP_011842338.1 RSPH17029_RS17125 TRAP transporter small permease
Query= uniprot:G8AR26 (179 letters) >NCBI__GCF_000015985.1:WP_011842338.1 Length = 184 Score = 103 bits (258), Expect = 1e-27 Identities = 60/167 (35%), Positives = 92/167 (55%), Gaps = 9/167 (5%) Query: 16 MALMLAVMVALVFGNVVLRYGFNSGIVAAEELARLMFVWLVFLGATLALRRHQHLGLDIL 75 + L L ++A+VF NVVLRY FNSGI E L+ L+FVW+ F GA L L H+G+D L Sbjct: 16 VVLCLGGILAMVFLNVVLRYLFNSGIFLTEGLSGLLFVWMTFAGALLVLYDGGHIGVDAL 75 Query: 76 QARLPARVRRACAVISHLLMIYALWLFIQGSWFQLLIGMETRSTVLSFPMAFYAAAGFFP 135 R+P +R +++H +M+Y W + GSW Q++I ++ + P+A AAG F Sbjct: 76 VRRVPVAAQRGLFLLAHAVMLYVSWQMLLGSWQQMVINLKVIAPGTRLPVALLYAAGVFF 135 Query: 136 AIAMALTIIANLWKILSG--DATAHIPGNGDPH-------GVTAPQG 173 A L ++ ++ +L+G +A PG + G AP+G Sbjct: 136 AGMSGLFLLHQMFLLLTGRLPQSALRPGTSEEESDVERHVGALAPEG 182 Lambda K H 0.331 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 91 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 184 Length adjustment: 19 Effective length of query: 160 Effective length of database: 165 Effective search space: 26400 Effective search space used: 26400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory