Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011842445.1 RSPH17029_RS17980 ATP-binding cassette domain-containing protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000015985.1:WP_011842445.1 Length = 236 Score = 169 bits (428), Expect = 5e-47 Identities = 97/248 (39%), Positives = 136/248 (54%), Gaps = 20/248 (8%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 +L++ + RFGGL A+ DV + ++ GQ+YGL+GPNGAGKTT N+I+GL P +G+ Sbjct: 3 LLQLEKLGVRFGGLVAVQDVSLAVEEGQIYGLLGPNGAGKTTLVNMISGLIRPTSGSLRF 62 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 AG+ P + + GI RTFQ R F ++ EN+ + G Sbjct: 63 AGEAGGPWPIADAVSRGIVRTFQQTRAFLGLSVRENLRIAA-------------AASGRD 109 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 A+ A EL++ G+G D A L Y R L IA AL P+L+ LDEPA G+ Sbjct: 110 ADAA-------ELIEAFGLGPVLDRPAGDLPYATLRHLGIALALTLKPRLLLLDEPAVGL 162 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 E +L LI T+LLIEH+V+ +M L DRV VLD G+ + EG A+ Q+N Sbjct: 163 TGGEVDRLARLIRDWNARGVTVLLIEHNVRFLMSLADRVAVLDRGRLLFEGTAADCQRNP 222 Query: 249 KVIEAYLG 256 +VI+ YLG Sbjct: 223 EVIDVYLG 230 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 236 Length adjustment: 24 Effective length of query: 236 Effective length of database: 212 Effective search space: 50032 Effective search space used: 50032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory