Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_011842447.1 RSPH17029_RS17990 enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::P30084 (290 letters) >NCBI__GCF_000015985.1:WP_011842447.1 Length = 257 Score = 141 bits (355), Expect = 2e-38 Identities = 85/245 (34%), Positives = 137/245 (55%), Gaps = 10/245 (4%) Query: 47 VGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNL 106 + ++ L+RP A NA+ + DE+ + EDPA+ VLTG K F G D+ + +L Sbjct: 16 LAVVTLDRPPA-NAVSLEVYDEIRRTFHRLGEDPAMRVAVLTGAGKVFCGGNDVNDFVDL 74 Query: 107 SFQDCYSSKFLKH----WDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQ 162 F ++++L H ++ L PV+ A+NG A G G LA +CDI A E+A FA Sbjct: 75 EFDR--ATEYLAHVRLTFNALYDCPIPVVGAINGAAVGTGIVLASLCDIRIASERAVFAL 132 Query: 163 PEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEA 222 PEI +G + GG++ + R G+ + M+ TG R+ A +A +A +V ++ P E ++ A Sbjct: 133 PEIDVGVL---GGSRHVMRLAGQGMTRWMMYTGRRVRADEALRARIVDEVVPPEEVMPRA 189 Query: 223 IQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEK 282 + AE+IAS S + +AK +N EM + EG + E L + T + +EG AF+EK Sbjct: 190 MAIAEEIASKSPPAIRLAKLGLNRTEEMNMKEGYEFECTLTAAVRRTPEAREGAMAFLEK 249 Query: 283 RKANF 287 R+ ++ Sbjct: 250 RQPSY 254 Lambda K H 0.319 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 257 Length adjustment: 25 Effective length of query: 265 Effective length of database: 232 Effective search space: 61480 Effective search space used: 61480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory