Align 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial; 3-hydroxyisobutyryl-coenzyme A hydrolase; HIB-CoA hydrolase; HIBYL-CoA-H; EC 3.1.2.4 (characterized)
to candidate WP_011842447.1 RSPH17029_RS17990 enoyl-CoA hydratase/isomerase family protein
Query= SwissProt::Q5XIE6 (385 letters) >NCBI__GCF_000015985.1:WP_011842447.1 Length = 257 Score = 77.4 bits (189), Expect = 4e-19 Identities = 62/199 (31%), Positives = 101/199 (50%), Gaps = 13/199 (6%) Query: 42 RGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGKAFCAGGDIKA 101 RG A V+TL+RP NA+SL + +I + DP + ++ GAG K FC G D+ Sbjct: 14 RGLA-VVTLDRPPA-NAVSLEVYDEIRRTFHRLGEDPAMRVAVLTGAG-KVFCGGNDVND 70 Query: 102 LSEAKKAGQTLSQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATER 161 + + T + + NA+ C P V I+G +G G+ L+ R+A+ER Sbjct: 71 FVDLEFDRAT---EYLAHVRLTFNALYDCPIPVVGAINGAAVGTGIVLASLCDIRIASER 127 Query: 162 SLFAMPETGIGLFPDVGGGYFLPRLQGK-LGYFLALTGFRLKGRDVHRAGIATHFVDSEK 220 ++FA+PE +G+ +GG + RL G+ + ++ TG R++ + RA I V E+ Sbjct: 128 AVFALPEIDVGV---LGGSRHVMRLAGQGMTRWMMYTGRRVRADEALRARIVDEVVPPEE 184 Query: 221 L---HVLEEELLALKSPSA 236 + + E +A KSP A Sbjct: 185 VMPRAMAIAEEIASKSPPA 203 Lambda K H 0.320 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 257 Length adjustment: 27 Effective length of query: 358 Effective length of database: 230 Effective search space: 82340 Effective search space used: 82340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory