Align TRAP transporter, subunit DctM (characterized, see rationale)
to candidate WP_011842464.1 RSPH17029_RS18075 TRAP transporter large permease
Query= uniprot:I7DRS6 (467 letters) >NCBI__GCF_000015985.1:WP_011842464.1 Length = 432 Score = 268 bits (684), Expect = 3e-76 Identities = 162/462 (35%), Positives = 242/462 (52%), Gaps = 39/462 (8%) Query: 1 MDVVLLFSMVIGLLLIGVPIAVALGLSSTLFLLIYSDSSLASVAGTLFEAFE----GHFT 56 + V L FS + L+ G+ I VA L S + + + + F +F Sbjct: 2 LPVFLTFS-ALTLITCGLMIGVAAALVSIIGGMALFGDPFGARVPMMISRFAIDRIDNFL 60 Query: 57 LLAIPFFILASSFMTTGGVARRIIRFSIACVGHLPGGLAIAGVFACMLFAALSGSSPATV 116 LLA+PFFILA M TGGV R+ F V L GGL A V A +FA +SGS+ A V Sbjct: 61 LLAVPFFILAGRLMNTGGVTVRLFDFVAVLVQPLRGGLGYANVMASFVFAGMSGSATADV 120 Query: 117 VAIGSIVIAGMRQVGYSKEFAAGVICNAGTLGILIPPSIVMVVYAAAVEVSVGRMFLAGV 176 V +GSI + MR GY + F+AGV + LG +IPPSIV++ YA E SV +FLA + Sbjct: 121 VGLGSIEMKAMRSNGYPEGFSAGVTAASSLLGPVIPPSIVLIAYAVQAEQSVATLFLAAI 180 Query: 177 IPGLMAGLMLMVTIYVMAKVKNLPKGEWLGWGEVAASAANASVGLLLIGIILGGIYGGIF 236 +PG++ MV + + ++ LP G W EV A +A + LL GIIL GIYGGIF Sbjct: 181 VPGILLAACFMVWVALESRRLKLPAGSWPSGREVRIKALHAILPLLTPGIILAGIYGGIF 240 Query: 237 TPTEAAAVASVYAFFVATFVYRDMGPLKSAPKPKDMGQFLTMLPKMLGQTVVYFIPSFFH 296 TPTEAAAVA +YA + TFVYR+M + T L ++ G + Sbjct: 241 TPTEAAAVAVLYALLLTTFVYREM-------------NWRTFLAELKGTALD-------- 279 Query: 297 ADTRHALFEAGKLTVTLLFVIANALILKHVLTDEQVPQQIATAMLSAGFGPVMFLIVVNV 356 T TL+F+IA ++ +PQ + ++ P + + ++ V Sbjct: 280 -------------TATLMFIIAMTSAFGVIMLRLGLPQAMVGIVVGISENPTIVMFLMLV 326 Query: 357 ILLIGGQFMEPSGLLVIVAPLVFPIAIELGIDPIHLGIIMVVNMEIGMITPPVGLNLFVT 416 + L+ G FM + ++I+ P++ PIA G D IH GI+M + + IG++TPPVG+ L+ Sbjct: 327 VWLLVGCFMAQTPAIIILTPILMPIADRFGFDMIHFGIVMAMALTIGLLTPPVGMVLYAL 386 Query: 417 SGVAGMPMMAVVRAALPFLAVLFVFLIMITYIPWISTVLPNA 458 VA +P+ + R +P++ + +F+ ++ +P + T LP A Sbjct: 387 RKVADVPLAILFRVVMPYIVIAILFISLLILVPQLVTALPYA 428 Lambda K H 0.329 0.144 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 467 Length of database: 432 Length adjustment: 33 Effective length of query: 434 Effective length of database: 399 Effective search space: 173166 Effective search space used: 173166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory