Align Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 (characterized)
to candidate WP_011842470.1 RSPH17029_RS18110 glutathione S-transferase family protein
Query= SwissProt::P57113 (216 letters) >NCBI__GCF_000015985.1:WP_011842470.1 Length = 198 Score = 52.8 bits (125), Expect = 5e-12 Identities = 58/201 (28%), Positives = 85/201 (42%), Gaps = 22/201 (10%) Query: 8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALKIDGI 67 LY SS S +V L G D+ + P + G + EF+ +NP +VP LK Sbjct: 4 LYGRPNSSNSAKVFWLLDELGADWRLEPAG--RGFGPTDTPEFRAMNPFGKVPVLKDGET 61 Query: 68 TIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIA-SGIQPLQNLSVLKQVGQEN 126 + +S AIL YL P P L P+ R+ + D A S PL L + G Sbjct: 62 VVWESHAILRYLGTREPTP-LWPEGAAARSRIDRWMDWAAISFTPPLTRLRKARGAGASG 120 Query: 127 QMPWAQKAITSGFNALEKILQSTAGKYCVGDEVSMADVCLAPQV-------------ANA 173 + A+ +G AL+ L +Y G ++S+AD+ +P V N Sbjct: 121 EAD--LPAVLAGARALDGWL--ARHRYLAGCDLSLADIAASPSVHRWFRLPEAAEALPNL 176 Query: 174 ERFKVDLSPYP-TISHINKAL 193 R++ DL+ P HI AL Sbjct: 177 ARYRDDLARNPGYCRHIRDAL 197 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 82 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 198 Length adjustment: 21 Effective length of query: 195 Effective length of database: 177 Effective search space: 34515 Effective search space used: 34515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory