Align glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized)
to candidate WP_011842476.1 RSPH17029_RS18140 ABC transporter permease subunit
Query= CharProtDB::CH_011913 (426 letters) >NCBI__GCF_000015985.1:WP_011842476.1 Length = 398 Score = 249 bits (635), Expect = 1e-70 Identities = 155/412 (37%), Positives = 236/412 (57%), Gaps = 35/412 (8%) Query: 17 LIYDTRFRSITIQIVVLLLFLAGLVWLLNNAYVNLEAKGKDFNFSFLWTRAGYDLAQTLI 76 ++Y FR++ QI + +L N NL + F FL + +++ +TLI Sbjct: 20 ILYSESFRTVVYQIALAAAVALLGFYLYQNVVENLARQNIATGFGFLGQVSQFEIGETLI 79 Query: 77 PYSNDDTHFRALIEGLLNTLLVSVLGCILATILGTIIGVLRLSQNWLVARIMTVYVETFR 136 YS DT+ RAL GL+NTL VS G ++AT++G +G+ R+S NWL+ R+ T YVE R Sbjct: 80 AYSARDTYGRALAVGLMNTLSVSAAGIVVATVIGFSVGIARVSSNWLLQRLATAYVEIVR 139 Query: 137 NIPLLLWILLMGTILAETRPVPKDFRLTEAMKAAGEEPKASMWFFDSVAVTNRGTNLPAP 196 NIP++L ++ ++ P P+ +A++ G M F ++NRG P Sbjct: 140 NIPVILQVIFWAAVIRNL-PAPR-----QAVELWG------MGF-----LSNRGLTFAMP 182 Query: 197 AFDHSLGVVDLGWNLPVSLNALAILAVMSASFWGWRRFMARAKAVQEATGTRPTTWWPSL 256 + H+ + W L + +A LA++++ +AK +EATG WP + Sbjct: 183 SA-HAAHL----WMLAALVAGIA-LAILASH---------KAKRHREATGRYIDMLWPCV 227 Query: 257 -LILFAPISALL-YGLGFHLDYPQITKFDFTGGFQMLHSFTALLIALTLYTAAFIAEIVR 314 LI+ P+ L +G + +P+ F+F GG + F AL+ ++LY++ FIAEIVR Sbjct: 228 GLIVGLPLLVWLGFGAPHEISFPERRGFNFAGGATISPEFVALMTGISLYSSGFIAEIVR 287 Query: 315 AGIQAISRGQTEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSY 374 AGIQA RGQ EAA ++ LRP + V+LPQALRVIVPPL SQ+++L KNSS+A+ + Y Sbjct: 288 AGIQATPRGQVEAARSIALRPRFILRYVVLPQALRVIVPPLTSQYVSLIKNSSIAVVIGY 347 Query: 375 MDLRGTLGGITLNQTGRELECMLLMMLIYLTISLTISSLMNLYNKSIKLKER 426 DL +G +NQTG+ +E + +MML+YL +SL S LMN YN+ + +KER Sbjct: 348 PDL-VNIGNTVMNQTGQAVEAIAVMMLVYLIVSLVTSLLMNFYNRLVAIKER 398 Lambda K H 0.326 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 398 Length adjustment: 31 Effective length of query: 395 Effective length of database: 367 Effective search space: 144965 Effective search space used: 144965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory