Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_011842508.1 RSPH17029_RS18310 SDR family oxidoreductase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_000015985.1:WP_011842508.1 Length = 255 Score = 136 bits (343), Expect = 4e-37 Identities = 86/249 (34%), Positives = 140/249 (56%), Gaps = 5/249 (2%) Query: 5 LNGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLT 64 L G+ ITG G+GRA A +A GA+V++N + + + A E++ E D VLT Sbjct: 8 LTGRTALITGSSRGLGRAFAEGLAGAGARVILNGVNTARLEEAAAEMRAEGFD----VLT 63 Query: 65 IPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAF 124 D++ + E + E+++ ++NAG+ + LE+ + ++INL +F Sbjct: 64 AAFDVADEAAIKAAFETLDAEGIEVDILMNNAGIQFRKPMLELDTADWQRVIDINLTASF 123 Query: 125 FAIQAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYGI 184 + AA++M +G+G II I S+++ + A YT K GI L ++ A G+ GI Sbjct: 124 VIGREAARRMAARGRG-KIINIGSLTSELARATVAPYTVAKGGIKMLTKAMAAEWGEKGI 182 Query: 185 RCNAILPGTISTALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYVNG 244 + NAI PG + T +NE L +PE +++ R P+ R G P+++AG AI+LASD SNYV+G Sbjct: 183 QSNAIGPGYMVTDMNEALLSNPEFDGWVKARTPMRRWGLPEELAGTAIYLASDASNYVSG 242 Query: 245 AQLLVDGGL 253 + DGG+ Sbjct: 243 QIIYADGGM 251 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory