Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_011842525.1 RSPH17029_RS18400 SDR family oxidoreductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000015985.1:WP_011842525.1 Length = 251 Score = 146 bits (369), Expect = 4e-40 Identities = 100/253 (39%), Positives = 142/253 (56%), Gaps = 25/253 (9%) Query: 9 IVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL-GDNARFAVADISDEQAAQ 67 +++G ASG+G +M V G +V ++DL A+EA A + G A DI+DE A + Sbjct: 10 VLTGGASGIGRGILEMAVAQGYRVGVLDLAGPALEAVASDFAGAAVHVAATDITDEAAVE 69 Query: 68 SAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHG---LASFAKVINVNLIGSFNLLRL 124 A A +AFG+ G++NCAGI G+ P +A F ++++VN+IGSF + R Sbjct: 70 EAFSALDAAFGAPWGVINCAGI-------GQNTPFAETTVAQFRRILDVNVIGSFLVARA 122 Query: 125 AAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARFGI 184 AAA M + GVI+N S++ G G+AAY SKGA+ +LT A ELA GI Sbjct: 123 AAARM---------KGGVIVNITSVSGIQGSTGRAAYGTSKGAVNTLTRILATELAPQGI 173 Query: 185 RVMTIAPGIFETPMMAGMSDE-VRASLAAGVPFPPRLGRPQEYAALARHIIENSM---LN 240 RV IAPG ETPM A DE R + + VP R G +E AA+A +I++ + +N Sbjct: 174 RVNAIAPGPVETPMAARWHDEATRRTWVSRVPM-GRYGTVEEIAAMALTLIDDRISGYVN 232 Query: 241 GEVIRLDGALRMA 253 G+VI +DG A Sbjct: 233 GQVIAVDGGFSSA 245 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory