Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate WP_011842735.1 RSPH17029_RS19745 NAD(P)-dependent oxidoreductase
Query= SwissProt::P28811 (298 letters) >NCBI__GCF_000015985.1:WP_011842735.1 Length = 288 Score = 104 bits (259), Expect = 3e-27 Identities = 86/277 (31%), Positives = 125/277 (45%), Gaps = 9/277 (3%) Query: 2 TDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVV 61 T + G G MG A L + G V V++ P V+ GA+ AL+ A++V Sbjct: 4 TVVGIAGTGRMGTAFARRLCETGVPVRVWNRSPDRTGAAVDAGAEAV--ALEALADADLV 61 Query: 62 ISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPV 121 + L E++ G + A +AG+ ++++ ST+ P+ A + A A G L PV Sbjct: 62 LLSLTDAAASEAVLAG---MGAALAGR-IVVEMSTLLPDQAEALEAQATALGAQFLHCPV 117 Query: 122 SGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGIL 181 G V A G L GGPAE RARPVLE + R + H G GA K+ N+ L + Sbjct: 118 GGTVAPALKGQLLGFAGGPAETLDRARPVLERLCRRVEHLGPVGAAARMKLAVNLPLALY 177 Query: 182 MAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQV 241 E+L L G+ +M +SSGG L V+ + G F + Sbjct: 178 WQTLGESLLLLRGAGVPAEQAIGLMAESSGGPAVL---KNRAQVVVETLEGADQRGTFDI 234 Query: 242 RLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQA 278 + KDL LALA A+ A+ PL A A + +A Sbjct: 235 AGLAKDLHLALALAEREGAALPLSAAAEERYRAALEA 271 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 288 Length adjustment: 26 Effective length of query: 272 Effective length of database: 262 Effective search space: 71264 Effective search space used: 71264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory