Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011842826.1 RSPH17029_RS20330 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000015985.1:WP_011842826.1 Length = 232 Score = 160 bits (404), Expect = 3e-44 Identities = 93/224 (41%), Positives = 136/224 (60%), Gaps = 4/224 (1%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 LL+VNG+ +YG L GVD+ V +GE + ++G NG GK+T + TI G + RTG++ F Sbjct: 3 LLEVNGLHAWYGESHILHGVDLFVEEGETICILGRNGMGKTTTLRTIMGILRKRTGAIRF 62 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAEDVEKIFTLF 130 G+D+ +P H AR + PE R IF ++V ENL + + V +I+ LF Sbjct: 63 AGKDMMGVPLHRTAREGLGFVPEERGIFATLSVEENLMLP---PVVAKGGMSVGEIYELF 119 Query: 131 PRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRKLN 190 P LKER + G LSGGEQQML++ R L + LLLDEP+ GLAP+I++ I E + +L Sbjct: 120 PNLKERRSSPGTKLSGGEQQMLAMARILRTGARCLLLDEPTEGLAPVIIQRIGEVLIELR 179 Query: 191 EAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLAN 234 + G+TV LVEQN A +++ R Y+M +G++ +EL N Sbjct: 180 D-RGMTVVLVEQNFRFASKVADRFYLMDHGRMVADFPVEELPEN 222 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 232 Length adjustment: 23 Effective length of query: 224 Effective length of database: 209 Effective search space: 46816 Effective search space used: 46816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory