Align acetohydroxy-acid synthase small subunit (EC 2.2.1.6) (characterized)
to candidate WP_011868713.1 MMARC5_RS04830 acetolactate synthase small subunit
Query= metacyc::MONOMER-11901 (169 letters) >NCBI__GCF_000016125.1:WP_011868713.1 Length = 169 Score = 261 bits (668), Expect = 3e-75 Identities = 130/169 (76%), Positives = 155/169 (91%) Query: 1 MKNTHIISVLVLNKPGVLQRISGLFTRRWYNISSITGGSTDSTDISRMTIVVKGDDKVVE 60 M++ HIISVLVL+KPGVLQRISGLFTRRW+NISS+T GST++ D++RMTIVV+GDD V+E Sbjct: 1 MEHKHIISVLVLHKPGVLQRISGLFTRRWFNISSMTVGSTENPDVARMTIVVQGDDTVLE 60 Query: 61 QVVKQLNKLIEVIKVIDLDEEECVERELCLIKIYAPTESSKSQVIQYANIFRGNIVDLSQ 120 QVVKQLNKL+EVIKV DL+ + V+RELCL+K+YAPTE SKSQVIQYANIFRG IVDLS Sbjct: 61 QVVKQLNKLVEVIKVTDLNSNKSVQRELCLVKVYAPTEDSKSQVIQYANIFRGKIVDLST 120 Query: 121 ESLTVQITGDKTKISAFIKLVKPMGIKEISRTGLTALMRGPKILKSNKA 169 E+LTV+ITGD+ K++AF+ LV+PMGIKEI+RTGLTALMRG KILKSNKA Sbjct: 121 ETLTVEITGDEQKVNAFLDLVRPMGIKEIARTGLTALMRGSKILKSNKA 169 Lambda K H 0.317 0.134 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 169 Length adjustment: 18 Effective length of query: 151 Effective length of database: 151 Effective search space: 22801 Effective search space used: 22801 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_011868713.1 MMARC5_RS04830 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.2872.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.2872.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.